Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 3 of 91|Showing 101-150 of 4546
sepha.com favicon

SEPHA

sepha.com

65
ManufacturingUnited KingdommediumMEDIUM

SEPHA Ltd is a well-established UK-based manufacturer specializing in non-destructive leak testing, blister packing, and deblistering equipment primarily for the pharmaceutical and medical device industries. With over 40 years of industry experience and a strong reputation among leading pharmaceutical manufacturers, SEPHA offers a range of products and services including quality control solutions, packaging machinery, and contract packaging services. The website reflects a mature digital presence with professional design, clear navigation, and comprehensive content tailored to its B2B audience. Technically, the site is built on WordPress with integrations of HubSpot marketing tools, Google Analytics, and other modern web technologies, ensuring good SEO and mobile optimization. Security posture is solid with HTTPS and some security headers, though improvements such as enabling DNSSEC and adding a Content-Security-Policy header are recommended. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. Overall, SEPHA demonstrates strong business credibility and digital maturity, though it could enhance transparency by publishing explicit security policies and incident response information.

57
80
100
80
15
17
83
pharmaceuticalleaktestingblisterpackingmedicaldevicepackagingqualitycontrol+2 more
WordPressYoast SEOHubSpot FormsGoogle Tag Manager+5

Partner Domains:

tasigroup.com
partner
2026-07-10T07:23:42.501Z
satbill.co.uk favicon

Symbiosys Business Solutions Ltd

satbill.co.uk

66
TelecommunicationsUnited KingdommediumMEDIUM

Symbiosys Business Solutions Ltd operates the SATbill platform, a specialized satellite airtime billing solution designed for satellite service providers and operators worldwide. The company offers a comprehensive software product that supports billing for multiple providers, call types, and value-added services, with strong customization and integration capabilities. Their market position is supported by a global client base, multi-entity billing features, and significant invoicing volume, positioning them as a key player in the satellite telecommunications billing niche. Technically, the website is built on the HubSpot CMS platform, leveraging modern web technologies including Google Fonts, jQuery, and various analytics and marketing tools such as Google Analytics, Hotjar, and LinkedIn Insight. The site is well-optimized for mobile and accessibility, with good SEO practices and a professional design that enhances user experience. From a security perspective, the site enforces HTTPS, uses reCAPTCHA on forms, and benefits from HubSpot's security headers and infrastructure. However, the absence of explicit security policy pages and vulnerability disclosure mechanisms suggests room for improvement in transparency and incident response readiness. The WHOIS data is missing or indicates the domain may not be registered, which raises concerns about domain legitimacy despite the professional website content. Overall, the website presents a trustworthy and professional front for a specialized business solution, but the lack of WHOIS registration data and explicit security policies slightly reduce the overall trust score. Strategic recommendations include establishing clear security and incident response documentation, verifying domain registration, and enhancing transparency to strengthen stakeholder confidence.

44
70
60
100
75
17
83
satellitebillingtelecommunicationssoftwaresatcom+2 more
HubSpot CMSGoogle FontsjQuerySlick Carousel+7
2026-07-10T07:07:26.842Z
B

Belazu Ingredient Company

belazu.com

63
E-commerceUnited KingdomsmallMEDIUM

Belazu Ingredient Company operates a professional e-commerce platform specializing in premium Mediterranean and Middle Eastern food ingredients targeted at chefs and home cooks. The company has a well-established online presence with a domain registered since 2000, indicating a mature business. Their website offers a broad product range, free UK shipping over £50, and a dedicated trade site for business customers, positioning them as a niche premium supplier in the food retail sector. Technically, the website is built on the BigCommerce platform using the Stencil framework, integrating modern analytics and marketing tools such as Google Tag Manager, TikTok Pixel, Facebook Pixel, Hotjar, and Klaviyo. The site demonstrates good mobile optimization, clear navigation, and a professional design, supporting a positive user experience and effective e-commerce functionality. From a security perspective, the site enforces HTTPS and employs cookie consent mechanisms, but lacks explicit security headers and DNSSEC is not enabled. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with a comprehensive privacy policy and cookie consent. However, the absence of a published security policy or incident response contact is noted. Overall, the website presents a low-risk profile with strong business credibility and good technical implementation. Strategic improvements in DNS security and HTTP security headers would enhance the security posture further. The site is suitable for general audiences with no adult or questionable content detected.

70
100
65
64
68
2
55
ecommercefoodingredientsmediterraneanmiddleeastern+4 more
BigCommerceGoogle Tag ManagerTikTok PixelFacebook Pixel+2

Partner Domains:

trade.belazu.com
partner
sainsburys.co.uk
partner
2026-07-09T07:18:23.417Z
S

Sanderson Plc

highams.com

67
FinanceUnited KingdommediumMEDIUM

Sanderson Plc is a specialist recruitment consultancy focused on the Insurance, Life & Pensions, and Wealth Management sectors, with a strong market presence in the UK financial services industry. The website highlights the strategic acquisition of Highams to expand their capabilities and service offerings. The company provides a range of recruitment services including permanent and contract placements, RPO, MSP, and executive search. The site is professionally designed, well-structured, and optimized for SEO and mobile devices, reflecting a mature digital presence. Technically, the website is built on WordPress with modern plugins and integrations such as HubSpot for analytics and messaging, Google Tag Manager, and CookieYes for consent management. Security measures include HTTPS, Google reCAPTCHA Enterprise, and cookie consent mechanisms, although explicit security headers could be more visible. No critical vulnerabilities or exposed sensitive data were detected. The WHOIS data for the domain is missing or unavailable, which slightly reduces trustworthiness but is mitigated by the professional content and business legitimacy evident on the site. Overall, the website demonstrates a strong security posture, good privacy compliance, and a credible business presence in the financial recruitment sector.

100
80
83
47
15
70
57
recruitmentfinancialservicesinsurancepensionswealthmanagement+4 more
WordPressYoast SEO pluginjQueryHubSpot analytics and messaging+4

Partner Domains:

highams.com
subsidiary
sanderson.ie
partner

+2 more partners

2026-07-09T07:14:47.592Z
macroberts.com favicon

Morton Fraser MacRoberts LLP

macroberts.com

76
OtherUnited KingdomlargeLOW

Morton Fraser MacRoberts LLP (MFMac) is a leading Scottish law firm providing expert legal services to businesses, the public sector, and individuals. The firm is well-positioned in the Scottish legal market, recognized by prestigious legal directories such as Chambers and Partners and Legal 500. Their services span multiple sectors including energy, real estate, public sector, manufacturing, and healthcare. The website reflects a professional and comprehensive digital presence with clear navigation, rich content, and strong branding consistency. Technically, the website leverages modern technologies including Umbraco CMS, Google Tag Manager, Microsoft Application Insights, Hotjar, and Usercentrics for consent management. The site is mobile-optimized, accessible, and SEO-friendly. Security posture is strong with HTTPS enforced, security headers present, and use of reCAPTCHA on forms. Privacy compliance is well addressed with detailed policies and consent mechanisms. The WHOIS data is unavailable, which limits transparency on domain registration details. However, the website content and business information strongly indicate legitimacy and professionalism. No critical security vulnerabilities or compliance gaps were detected. Overall, the site demonstrates a mature digital infrastructure suitable for a large professional services firm.

67
83
80
100
70
55
70
lawfirmlegaladvisorsscottishlawlegalservicesemploymentlaw+5 more
JavaScriptjQueryGoogle Tag ManagerGoogle Analytics (gtag.js)+5
2026-07-09T07:10:52.595Z
concrete.org favicon

American Concrete Institute

concrete.org

52
ManufacturingUnited StateslargeMEDIUM

The American Concrete Institute (ACI) website for the Western Europe region serves as a professional portal providing access to standards, educational programs, certification, and technical resources related to concrete design and construction. The organization is positioned as a global authority in the concrete industry, targeting professionals and organizations involved in concrete materials and construction. The website content is relevant and well-structured, supporting the business model of standards development and education. Technically, the site is built on ASP.NET WebForms and uses the DotNetNuke CMS platform. It integrates multiple analytics and marketing tools including Google Analytics, Microsoft Clarity, Hotjar, LinkedIn Insight Tag, and Bing Ads. The site demonstrates good mobile optimization and SEO practices but has basic accessibility features. Performance is moderate, with room for improvement in modernizing the tech stack and enhancing security headers. From a security perspective, the site uses HTTPS but lacks visible security headers and explicit privacy or cookie policies on the analyzed page. There is no evidence of published incident response or vulnerability disclosure policies. The WHOIS data is malformed and missing critical registration details, which reduces domain trustworthiness despite the professional appearance of the website. Overall, the site is functional and professional but would benefit from enhanced privacy compliance, improved security practices, and transparent domain registration information to strengthen trust and compliance posture.

20
85
85
47
35
58
17
concreteaciconstructionstandardseducation+2 more
Google AnalyticsMicrosoft ClarityLinkedIn Insight TagHotjar+4
2026-07-08T07:26:06.743Z
sweatybetty.com favicon

SWEATY BETTY LIMITED

sweatybetty.com

67
RetailUnited KingdommediumMEDIUM

Sweaty Betty Limited is a well-established British retailer specializing in women's activewear, founded in 1998 and headquartered in London. The company operates a professional e-commerce platform offering a wide range of fitness and yoga clothing designed for women, combining style and performance. The brand enjoys a strong market position in the retail sector with a focus on quality and customer experience. Technically, the website leverages modern technologies including Salesforce Commerce Cloud, React, and integrates multiple analytics and marketing tools such as Google Analytics, Bazaarvoice, and Dynamic Yield. The platform is optimized for performance, mobile responsiveness, and accessibility, reflecting a mature digital infrastructure. Security posture is robust with HTTPS enforcement, comprehensive security headers, and bot protection via reCAPTCHA. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. However, the absence of WHOIS registration data introduces some uncertainty regarding domain legitimacy, although the overall business credibility remains high based on website content and branding. Strategic recommendations include enhancing transparency around security policies and incident response, maintaining up-to-date third-party components, and considering a public vulnerability disclosure policy.

52
87
100
85
50
2
73
activewearwomensfashione-commercefitnessclothingretail+2 more
Google Tag ManagerGoogle AnalyticsGoogle reCAPTCHA v3Bazaarvoice+9

Partner Domains:

klarna.com
partner
adyen.com
partner

+3 more partners

2026-07-08T07:20:20.647Z
sohoeditors.com favicon

Soho Editors

sohoeditors.com

55
MediaUnited KingdommediumMEDIUM

Soho Editors is a well-established UK-based freelance talent agency and training provider specializing in post-production recruitment and education. Founded in 1997, the company offers a comprehensive range of services including freelance and permanent recruitment, bespoke and online training courses, and project support for media professionals. Their market position is strong within the UK media sector, supported by a professional website with clear navigation and rich content tailored to post-production professionals and companies seeking creative talent. Technically, the website employs a modern tech stack including Bootstrap, jQuery, Google Analytics, Tag Manager, and various marketing and tracking tools. The site is mobile-optimized with good SEO practices and moderate performance. Hosting and domain registration are consistent with the business profile, though DNSSEC is not enabled. Security measures include HTTPS enforcement and Google reCAPTCHA on forms, but there is room for improvement in security headers and explicit security policies. The security posture is solid but could be enhanced by enabling DNSSEC and adding security headers such as CSP and HSTS. Privacy compliance is strong with clear privacy and cookie policies, GDPR consent mechanisms, and multiple contact points. No critical vulnerabilities or suspicious content were detected. Overall, the website presents a professional and trustworthy digital presence with extensive marketing and analytics integration. Strategically, Soho Editors should focus on improving DNS security, publishing a formal security policy, and enhancing HTTP security headers to further strengthen their security posture and trustworthiness.

70
67
40
75
80
2
20
post-productiontalentagencytrainingfreelancerecruitment+2 more
BootstrapjQueryGoogle AnalyticsGoogle Tag Manager+9
2026-07-07T07:07:38.914Z
ronset.co.uk favicon

Ronset Printers Ltd

ronset.co.uk

46
OtherUnited KingdomsmallHIGH

Ronset Printers Ltd is a well-established family-run digital printing company based in Blackburn, UK, with over 50 years of experience. They specialize in a wide range of printing services including business cards, leaflets, posters, brochures, banners, stickers, large format printing, and signage. The company targets local businesses and organizations, offering high-quality print solutions with fast turnaround and excellent customer service. Their market position is that of a trusted local printing specialist with a strong reputation supported by positive Google reviews. Technically, the website is built on WordPress CMS and employs a modern technology stack including jQuery, Google Tag Manager, Google Analytics, Hotjar, and Sendinblue for marketing and analytics. The site is mobile-optimized with good SEO practices and a moderate performance profile. Security posture is solid with HTTPS enforced and use of reCAPTCHA, though some security headers are missing and could be improved. From a security and compliance perspective, the site implements cookie consent mechanisms but lacks an explicit privacy policy and terms of service pages on the homepage. No incident response or security policy information is found. WHOIS data lookup failed due to querying the subdomain rather than the registered domain, but this is a technical issue rather than a trust concern. Overall, the site demonstrates a good security baseline with room for improvement in policy transparency and security headers. The overall risk assessment is low, with the site appearing legitimate and professionally maintained. Strategic recommendations include publishing comprehensive privacy and security policies, enhancing security headers, and maintaining up-to-date software to mitigate vulnerabilities.

47
65
70
20
65
2
15
printingdigitalprintingbusinesscardsleafletsbrochures+6 more
jQuery 2.2.4Google Tag ManagerGoogle Analytics (gtag.js)Sendinblue (sibautomation.com)+7
2026-07-06T07:18:00.987Z
mockridge.com favicon

Mockridge Labels & Nameplates Ltd

mockridge.com

67
ManufacturingUnited KingdommediumMEDIUM

Mockridge Labels & Nameplates Ltd is a well-established UK-based manufacturer specializing in high-quality custom labels and nameplates. Founded in 1966, the company holds a leading market position in bespoke label manufacturing, offering a wide range of products including digital labels, domed labels, screen printing, anodised and etched nameplates, asset labels, and roll labels. Their target audience primarily consists of businesses requiring durable and visually appealing product identification solutions. The company demonstrates strong trust indicators such as ISO 9001 and UL certifications, Chamber of Commerce membership, and a comprehensive privacy and cookie compliance framework. Technically, the website is built on WordPress with Oxygen Builder, leveraging modern analytics and marketing tools like Google Analytics, Hotjar, and Facebook Pixel, and is hosted behind Cloudflare for performance and security. Security posture is solid with HTTPS enforced, domain locking, and consent management, though DNSSEC is not enabled and no public security policy or incident response plan is found. Overall, the website is professional, secure, and compliant, reflecting a mature digital presence aligned with business credibility.

32
100
85
75
80
17
65
customlabelsmanufacturingukbusinessprivacycompliantisocertified+3 more
WordPressOxygen BuilderjQueryGoogle Tag Manager+4

Partner Domains:

www.gmchamber.co.uk
partner
www.ul.com
partner

+2 more partners

2026-07-06T07:17:39.989Z
I

Institute of Food Technologists

ift.org

64
EducationUnited StateslargeMEDIUM

The Institute of Food Technologists (IFT) is a well-established non-profit professional organization dedicated to advancing food science and technology. It serves a global audience of food scientists, researchers, educators, and industry professionals by providing educational resources, certifications, and networking opportunities. The website reflects a mature digital presence with comprehensive content and professional branding, positioning IFT as a leader in its sector. Technically, the website employs modern web technologies including Google Fonts, FontAwesome, VideoJS for media, and multiple analytics and marketing tools such as Google Tag Manager, Hotjar, HubSpot, and Feathr. The site is mobile-optimized and demonstrates good SEO and accessibility practices, although some CMS or hosting details are not explicitly identified. From a security perspective, the site enforces HTTPS and includes several important security headers, indicating a strong baseline security posture. However, there is no publicly visible security policy or incident response information, and no vulnerability disclosure mechanism was found. The WHOIS data is unavailable or malformed, which slightly reduces trust but does not contradict the professional nature of the site. Overall, the site is low risk with strong business credibility and technical implementation. Strategic recommendations include publishing a formal security policy, adding vulnerability disclosure information, and providing incident response contacts to enhance transparency and trust.

100
80
70
74
25
65
17
foodscienceeducationprofessionalassociationnon-profittechnology+4 more
Google FontsFontAwesomeVideoJSGoogle Tag Manager+6
2026-07-05T07:17:22.191Z
blythwood.com favicon

Blythwood Veterinary Ltd

blythwood.com

65
HealthcareUnited KingdommediumMEDIUM

Blythwood Veterinary Ltd operates as a leading veterinary service provider in North London, offering a comprehensive range of pet healthcare services across multiple clinic locations including Stanmore, Hatch End, Northwood, and Bushey. The website targets pet owners in the region, providing appointment booking, pet health plans, and specialized care services. The business is positioned as a trusted regional veterinary provider with a medium-sized operation and a professional online presence. Technically, the website is built on Joomla CMS and incorporates modern web technologies such as jQuery, Google Tag Manager, Facebook Pixel, Hotjar, and OneTrust for cookie consent management. The site is mobile optimized with good SEO practices and moderate performance. However, some technical improvements could be made in accessibility and security headers. From a security perspective, the site uses HTTPS and implements cookie consent mechanisms, but lacks visible security headers and explicit security or incident response policies. No critical vulnerabilities were detected in the provided content. The absence of WHOIS registration data raises concerns about domain legitimacy, though the website content and business information appear professional and credible. Overall, the website presents a solid business and technical foundation with room for improvement in security best practices and transparency regarding privacy policies and domain registration. Verification of domain registration status is recommended to ensure full trustworthiness.

85
52
85
100
50
2
73
veterinaryhealthcarepetsnorthlondonvets+2 more
jQueryGoogle Tag ManagerFacebook PixelHotjar+1
2026-07-05T07:07:36.061Z
athenaeumhotel.com favicon

The Athenaeum Hotel & Residences

athenaeumhotel.com

65
HospitalityUnited KingdommediumMEDIUM

The Athenaeum Hotel & Residences is a luxury 5-star hotel located in the heart of Mayfair, London, offering upscale accommodation, dining, spa, and event services. The website reflects a well-established hospitality business with a rich history dating back to 1850, targeting affluent travelers, families, and long-stay guests. The site features a professional design, clear navigation, and integrated booking systems, enhancing user experience and business operations. Technically, the website utilizes modern frameworks and libraries including Umbraco CMS, Bootstrap, and various analytics and tracking tools such as Google Analytics, Hotjar, and Microsoft Clarity, indicating a mature digital infrastructure. Security posture is strong with HTTPS enforcement and security headers, though explicit security policies and incident response information are not publicly visible. Privacy compliance is partially addressed with privacy and cookie policies and consent mechanisms, but could be improved with clearer GDPR indicators and data retention disclosures. The absence of WHOIS data for the domain is a notable concern for transparency, though the website content and branding strongly suggest legitimacy. Overall, the site scores well in content quality, technical implementation, and business credibility, with recommendations to enhance security transparency and domain registration clarity.

85
37
100
80
17
53
65
luxuryhotelmayfairbookingspa+4 more
BootstrapTiny SliderFontAwesomeVimeo Player+8
2026-07-04T07:27:34.525Z
U

Universal Converting Equipment

universalconvertingequipment.com

60
ManufacturingUnited KingdommediumMEDIUM

Universal Converting Equipment is a UK-based manufacturer and supplier specializing in converting machinery such as slitter rewinders, core cutters, salvage rewinders, and hot melt coating systems. The company positions itself as a leading global supplier with a focus on substantial construction, simple operation, and worldwide support. Their business model targets industrial manufacturers and converting industry professionals worldwide, leveraging a B2B approach. The website reflects a professional and consistent brand image with clear product offerings and UK-based contact information. Technically, the website is built on WordPress using a modern stack including Yoast SEO, Google Tag Manager, and GDPR-compliant cookie management. The site is mobile-optimized with good SEO and accessibility basics. Analytics and marketing tools such as Google Analytics, Hotjar, Facebook Pixel, and LinkedIn Insight Tag are integrated with user consent mechanisms. From a security perspective, the site enforces HTTPS and uses reCAPTCHA for forms, but lacks explicit security policy or incident response disclosures. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of WHOIS domain registration data raises concerns about domain legitimacy and trustworthiness, warranting further verification. Overall, the website presents a solid digital presence for an industrial equipment supplier with good privacy compliance and marketing practices. Strategic recommendations include enhancing security headers, publishing security policies, and resolving WHOIS data inconsistencies to improve trust and compliance.

15
80
17
85
37
70
100
manufacturingindustrialequipmentslitterrewindershotmeltcoatingcorecutters+4 more
WordPressYoast SEO pluginGoogle Tag ManagerGoogle Analytics+7
2026-07-03T07:28:59.055Z
oglemodels.com favicon

Ogle Models & Prototypes Ltd

oglemodels.com

55
ManufacturingUnited KingdommediumMEDIUM

Ogle Models & Prototypes Ltd is a well-established UK-based company specializing in rapid prototyping, model making, and 3D printing services. With over 70 years of experience, the company serves a diverse range of industries including aerospace, automotive, medical, and product design. Their key services include advanced manufacturing techniques such as SLS, SLA, FDM 3D printing, CNC machining, vacuum casting, and finishing processes. The website reflects a mature digital presence with comprehensive service descriptions, client testimonials, and a professional design that supports their market position as a leading prototype engineering firm. Technically, the website is built on WordPress with modern frameworks like Bootstrap and integrates multiple analytics and marketing tools such as Google Analytics, Facebook Pixel, Hotjar, and LiveChat for customer engagement and data insights. The site is mobile-optimized, SEO-friendly, and includes structured data for enhanced search engine visibility. Security measures include HTTPS enforcement, reCAPTCHA on forms, and cookie consent mechanisms, although additional HTTP security headers could further strengthen the security posture. From a security and compliance perspective, the site demonstrates good privacy and cookie policy implementations aligned with GDPR requirements. However, no explicit security policy or incident response contact information is published, which could be improved. The WHOIS data for the domain is unavailable, which raises some transparency concerns, but the overall legitimacy is supported by the professional content, certifications, and client base. Overall, Ogle Models presents a trustworthy and professional online presence suitable for its B2B manufacturing audience. Strategic recommendations include enhancing security headers, publishing a security policy, and improving WHOIS transparency to further bolster trust and compliance.

42
100
70
45
15
68
17
rapidprototyping3dprintingmodelmakingmanufacturingengineeringprototypes+2 more
jQueryBootstrapGoogle Tag ManagerGoogle Analytics+5
2026-07-03T07:28:08.729Z
fletchersengineering.co.uk favicon

Fletchers Engineering

fletchersengineering.co.uk

47
ManufacturingUnited KingdommediumHIGH

Fletchers Engineering is a well-established UK-based engineering company specializing in HVAC fabrication, installation, and maintenance services. With over 30 years of industry experience, the company serves a diverse range of sectors including energy, manufacturing, hospitality, and government. Their website reflects a professional and comprehensive presentation of their services, supported by multiple industry accreditations and certifications, positioning them as a reputable player in their market segment. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery and Slick Slider, and integrates key tools like Google Analytics, Hotjar, and Google reCAPTCHA for analytics and security. The site is mobile-optimized and includes GDPR-compliant cookie consent mechanisms, indicating a mature digital presence. However, some improvements in accessibility and security headers could enhance the technical posture. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms, but lacks explicit security policies and incident response information. The WHOIS data is unavailable due to a query on the subdomain rather than the registered domain, which slightly reduces trustworthiness from a domain registration standpoint. Overall, the security posture is good but could benefit from additional transparency and technical hardening. The overall risk assessment is moderate-low, with the main concerns being the incomplete WHOIS data and absence of published security policies. Strategic recommendations include verifying domain registration details, implementing security.txt and incident response pages, and enhancing HTTP security headers to improve trust and compliance.

20
80
25
2
60
40
67
hvacengineeringfabricationmaintenanceuk+4 more
WordPressjQuerySlick SliderGoogle reCAPTCHA+4
2026-07-03T07:14:36.022Z
crowncastle.com favicon

Crown Castle

crowncastle.com

61
TelecommunicationsUnited StatesenterpriseMEDIUM

Crown Castle is a leading telecommunications infrastructure provider in the United States, specializing in shared communications infrastructure such as cell towers, small cells, and fiber networks. The company positions itself as the nation's largest provider in this sector, targeting wireless carriers, public sector entities, industrial enterprises, property owners, and investors. Their business model focuses on leasing and managing infrastructure assets to enable wireless connectivity nationwide. The website reflects a mature enterprise with comprehensive service offerings and a strong market presence. Technically, the website employs a modern technology stack including Vue.js, jQuery, and integrates multiple marketing and analytics platforms such as Google Analytics, Microsoft Clarity, Hotjar, and Marketo. The site is mobile-optimized, accessible, and SEO-friendly, with fast to moderate performance. The use of reputable third-party services and secure form handling indicates a mature digital infrastructure. From a security perspective, the site enforces HTTPS and uses secure form submissions. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not evident in the HTML source, suggesting room for improvement. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The WHOIS data is unavailable, likely due to privacy protection, but the website's professionalism and consistency support its legitimacy. Overall, Crown Castle's website demonstrates a strong business and technical foundation with good security practices. Recommendations include enhancing security headers, publishing an incident response policy, and adding a vulnerability disclosure program to further strengthen trust and security posture.

80
100
85
47
17
15
58
telecommunicationsinfrastructurecelltowerssmallcellsfiber+3 more
jQuery 3.6.3Vue.js 2Marketo FormsGoogle Tag Manager+10

Partner Domains:

investor.crowncastle.com
subsidiary
2026-07-03T07:08:36.245Z
nortonpeskett.co.uk favicon

Norton Peskett Solicitors

nortonpeskett.co.uk

48
OtherUnited KingdommediumHIGH

Norton Peskett Solicitors is a well-established law firm based in East Anglia, UK, with a history dating back to the 1830s. The firm offers a comprehensive range of legal services to both individuals and businesses, including criminal defence, family law, employment law, residential and commercial property, injury claims, mediation, and wills and probate. With multiple branch offices and over 120 experienced employees, Norton Peskett holds a strong regional market position supported by numerous accreditations and client testimonials. The website reflects a professional and trustworthy business with clear contact information and a user-friendly design. Technically, the website is built on WordPress 7.0 with modern SEO and analytics tools such as Yoast SEO, Google Analytics, Google Tag Manager, and Hotjar. It employs HTTPS with good SSL configuration and uses Google reCAPTCHA to secure forms. Cookie consent mechanisms and a privacy policy indicate GDPR compliance. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contact is published. From a security perspective, the site demonstrates good practices including HTTPS enforcement, anti-phishing warnings, and form protection. The absence of WHOIS data is unusual but likely due to querying the subdomain 'www' rather than the root domain. Despite this, the business legitimacy is supported by consistent branding, accreditations, and detailed contact information. Overall, the site scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility. Recommendations include implementing comprehensive security headers, publishing a security policy and incident response contacts, and adding a security.txt file to facilitate vulnerability disclosures. These steps would enhance the security posture and trustworthiness further.

65
20
60
47
53
15
17
lawfirmsolicitorslegalserviceseastangliafamilylaw+5 more
WordPress 7.0Yoast SEO pluginGoogle AnalyticsGoogle Tag Manager+3

Partner Domains:

www.eastmediation.co.uk
partner
unity.online
partner
2026-07-02T07:19:51.531Z
ecipartners.com favicon

ECI Partners

ecipartners.com

61
FinanceUnited KingdommediumMEDIUM

ECI Partners is a growth-focused private equity firm specializing in supporting European businesses valued between £50 million and £350 million. The company positions itself as a strategic partner for growth, providing investment and support to mid-market businesses. The website reflects a professional and consistent brand image, targeting corporate clients in the finance sector primarily within the UK and Europe. The business model centers on private equity investment and partnership, aiming to foster growth in its portfolio companies. Technically, the website is built on WordPress and leverages a modern technology stack including jQuery, Google Tag Manager, Cookiebot for consent management, HubSpot and Pardot for marketing automation, and Hotjar for user behavior analytics. The site is hosted likely on WP Engine, indicating a managed hosting environment optimized for WordPress. The website demonstrates good SEO, accessibility, and mobile optimization, providing a positive user experience. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms, indicating awareness of privacy regulations. However, there is no explicit privacy policy or terms of service detected in the provided content, nor is there a security.txt or vulnerability disclosure page. WHOIS data is unavailable, which reduces trustworthiness from a domain registration perspective. No contact emails or phone numbers are explicitly provided, limiting direct communication channels. Overall, the website is professional and well-constructed but would benefit from enhanced transparency regarding privacy, security policies, and incident response contacts. The absence of WHOIS data is a concern but may be due to privacy protection or registry issues. Strategic recommendations include publishing clear privacy and terms policies, adding security contact information, and maintaining regular security audits of third-party scripts and integrations.

57
80
65
100
10
83
15
privateequityfinanceinvestmentgrowthbusiness+3 more
jQueryGoogle Tag ManagerCookiebotHubSpot+3
2026-07-02T07:18:40.251Z
am-energy.com favicon

A&M Energy Solutions

am-energy.com

66
EnergyUnited KingdommediumMEDIUM

A&M Energy Solutions is a UK-based medium-sized company specializing in the supply and installation of loft and cavity wall insulation products for homeowners, contractors, local authorities, and landlords. The company positions itself as a reliable energy-saving insulation contractor with multiple depots across the UK, offering bespoke solutions to improve energy efficiency and reduce energy bills. Their website reflects a professional and consistent brand image with clear navigation and relevant content tailored to their target audiences. Technically, the website is built on WordPress using common plugins such as Gravity Forms and Yoast SEO, with integrations for Google Analytics, Google Tag Manager, Hotjar, and Trustpilot for customer reviews. The site is mobile-optimized and includes GDPR-compliant cookie consent mechanisms. However, the use of an outdated jQuery version and lack of advanced security headers indicate areas for technical improvement. From a security perspective, the site enforces HTTPS and uses a consent management platform, but lacks visible security headers and incident response contact information. The absence of WHOIS registration data raises concerns about domain legitimacy, although the website content and business information appear credible. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website scores well on content quality, privacy compliance, and business credibility but could enhance its security posture and domain transparency. Strategic recommendations include updating technical components, implementing additional security headers, and publishing vulnerability disclosure information to strengthen trust and security culture.

32
85
85
100
65
80
2
energyinsulationloftinsulationcavitywallinsulationenergysaving+5 more
jQuery 1.12.4Gravity Forms pluginYoast SEO pluginGoogle Tag Manager+6
2026-07-02T07:16:57.330Z
baltic.art favicon

BALTIC Centre for Contemporary Art

baltic.art

66
Non-profitUnited KingdommediumMEDIUM

Baltic Centre for Contemporary Art is a well-established non-profit cultural institution located in the United Kingdom, focused on contemporary art exhibitions, events, and community engagement. The website reflects a mature digital presence with comprehensive content, clear navigation, and strong branding consistency. It serves a broad audience including art enthusiasts, local communities, families, and visitors. The business model emphasizes free public access to art and cultural experiences, supplemented by venue hire and retail services. Technically, the website employs modern web technologies such as jQuery, Swiper.js, and Litepicker, integrated with analytics and marketing tools including Google Analytics, Facebook Pixel, and Hotjar. The site is built on a proprietary CMS (You.Create by Grandad Digital) and demonstrates good mobile optimization and accessibility features, including the ReciteMe accessibility tool. From a security perspective, the site uses HTTPS with strong SSL configuration but lacks explicit security headers and a published security policy or incident response plan. The domain WHOIS data is transparent and consistent with the organization's identity, enhancing trustworthiness. Privacy and cookie policies are present and GDPR compliant, with an active consent mechanism. Overall, Baltic.art presents a professional, secure, and user-friendly platform that aligns well with its mission as a non-profit art centre. Strategic improvements in security headers and incident response transparency could further enhance its security posture and stakeholder confidence.

70
70
47
100
65
83
2
artcontemporaryartgalleryculturenon-profit+3 more
jQuery 3.6.1LitepickerSwiper.jsGoogle Analytics (GA4 and Universal Analytics)+3

Partner Domains:

shop.balticmill.com
partner
archive.baltic.art
partner

+2 more partners

2026-07-02T07:14:15.945Z
finkernagelross.com favicon

Finkernagel Ross

finkernagelross.com

54
Real EstateUnited KingdomsmallMEDIUM

Finkernagel Ross is a well-established international design company specializing in architecture, interior architecture, and interior design, serving high-end residential, commercial, and hospitality clients primarily in the UK and Europe. The company positions itself as a full-service provider with offices in London and Hamburg, emphasizing bespoke and sustainable design solutions. The website reflects a professional brand image with consistent branding and good content quality, targeting discerning clients seeking impactful design. Technically, the website is built on WordPress using Elementor and the JupiterX theme, integrating modern marketing and analytics tools such as Google Tag Manager, Facebook Pixel, Hotjar, and Mailchimp. The site is secured with HTTPS and uses reputable hosting and domain registration services, though DNSSEC is not enabled. Performance and mobile optimization are good, with basic accessibility features. From a security perspective, the site demonstrates a solid baseline with HTTPS and domain transfer protection, but lacks visible security headers and explicit security or incident response policies. Privacy compliance is partial, with a cookie policy and consent mechanism present but no clear privacy or terms of service pages detected. The presence of RIBA Chartered Practice certification adds trustworthiness. Overall, the website presents a low-risk profile with good business credibility and technical maturity. However, improvements in privacy transparency, security headers, and policy disclosures would enhance compliance and trust.

85
100
-
80
68
15
2
architectureinteriordesignribalondonsustainabledesign+3 more
WordPressElementorJupiterX themeGoogle Tag Manager+3
2026-07-02T07:07:37.096Z
stream-measurement.com favicon

JWF Ltd

stream-measurement.com

54
EnergyUnited KingdommediumMEDIUM

Stream Measurement Ltd, operating under JWF Ltd, is a leading UK supplier specializing in flow meters and related instrumentation for energy and industrial sectors. The company offers a comprehensive range of products including gas, steam, water, and energy flow meters, alongside services such as repair, refurbishment, calibration, and commissioning. Their market position is strong within the UK, supported by partnerships with major instrumentation brands like ABB, Sensus, and Dresser Actaris. The website reflects a professional business model focused on supplying instrumentation and providing technical services to industrial clients. Technically, the website employs modern web technologies including Google Tag Manager, LiveChat, Mautic, and Hotjar for analytics and marketing, alongside a responsive design framework (Foundation). The site is mobile-optimized and includes accessibility features, though some security headers are not explicitly detected. Performance is moderate, with good SEO and structured data enhancing search visibility. From a security perspective, the site uses HTTPS and implements cookie consent mechanisms aligned with GDPR requirements. However, explicit security policies and incident response information are absent, and WHOIS data for the domain is unavailable, which raises concerns about domain transparency. No vulnerabilities or exposed sensitive data were detected in the content. Overall, the website presents a trustworthy and professional front for Stream Measurement Ltd, though improvements in domain registration transparency and security header implementation are recommended to enhance trust and security posture.

85
47
20
70
20
95
17
flowmetersenergymeasurementcalibrationinstrumentationuksupplier+2 more
Google Tag ManagerGoogle Maps APILiveChatMautic+5

Partner Domains:

jwfltd.com
partner
2026-07-01T07:24:43.684Z
meritsoftware.co.uk favicon

Merit Software

meritsoftware.co.uk

54
TechnologyUnited KingdommediumMEDIUM

Merit Software is a UK-based specialist provider of payroll and invoicing software solutions tailored for temporary recruitment agencies, umbrella companies, healthcare agencies, and bureau sectors. Established since 1997, the company offers compliant, enterprise-grade SaaS products that address complex regulatory requirements such as GDPR, IR35, Apprenticeship Levy, and Pensions Auto-Enrolment. Their market position is supported by a strong reputation, award-winning customer service, and a comprehensive product suite including Merit Payroll, Merit Umbrella, and Merit Healthcare. Technically, the website is built on WordPress using the Cornerstone framework, leveraging modern analytics and tracking tools such as Google Analytics, Microsoft Clarity, Hotjar, and LinkedIn Insight. The site is mobile-optimized with good SEO and accessibility basics, though some improvements in accessibility and security headers could be made. Performance is moderate with a professional and consistent design. Security posture is solid with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. However, the absence of explicit security headers and a cookie consent mechanism are areas for improvement. The WHOIS data for the domain is missing or inconsistent, which raises some concerns about domain registration legitimacy, though the website content and business information appear credible and professional. Overall, Merit Software presents a trustworthy and mature business with a strong digital presence. Strategic recommendations include enhancing security headers, implementing cookie consent for compliance, publishing a vulnerability disclosure policy, and clarifying domain registration details to strengthen trust and compliance posture.

85
77
70
20
35
2
65
payrollsoftwarerecruitmentumbrellacompliance+4 more
WordPressjQueryGoogle AnalyticsMicrosoft Clarity+3
2026-07-01T07:22:37.502Z
Y

Youth Media (UK) Ltd

youthmedia.co.uk

56
MediaUnited KingdomsmallMEDIUM

Youth Media (UK) Ltd operates as a specialized digital marketing agency focused on student marketing and advertising across UK university campuses. Their services include targeted email campaigns, poster advertising, bookmarks, and mouse mats placed strategically in university libraries and learning centers. The company positions itself as an experienced media owner with over 15 years in the sector, leveraging academic endorsement and exclusive access to student audiences. The website content is professional and consistent with their business focus, targeting university students as their primary audience. Technically, the website employs a standard technology stack including jQuery, Bootstrap 3, Google Analytics, and Hotjar for analytics and user behavior tracking. The site is mobile responsive with good navigation and SEO optimization, though accessibility features are basic. Performance is moderate, and no CMS or hosting provider details are evident. Privacy and cookie policies are present but lack explicit consent mechanisms, and no contact emails or phone numbers are provided on the homepage, limiting direct communication channels. From a security perspective, the site uses HTTPS and includes tracking scripts but lacks visible security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were detected, but the absence of security best practices such as CSP or HSTS headers is noted. The WHOIS lookup failed due to domain registration issues, with no registrar or registrant data available, which raises concerns about domain legitimacy despite the professional website content. Overall, the website presents a moderate risk profile with good business credibility but gaps in security posture and privacy compliance. Strategic recommendations include improving security headers, adding explicit consent mechanisms, providing clear contact information, and verifying domain registration details to enhance trust and com…

42
75
70
100
15
68
2
studentmarketingdigitalmarketinguniversityadvertisingemailmarketingcampusadvertising
jQueryBootstrap 3Google AnalyticsHotjar
2026-07-01T07:20:57.267Z
A

A6 Motors Limited T/A A6 Motors

a6motors.co.uk

64
TransportationUnited KingdomsmallMEDIUM

A6 Motors Limited operates as a specialist used car dealership based in Bedfordshire, UK, offering a wide range of premium used vehicles with competitive pricing and finance options. The company emphasizes customer service and provides additional services such as vehicle valuation, part exchange, and warranty offerings. The website reflects a professional and trustworthy business with FCA authorization and AA Dealer Promise certification, enhancing its credibility in the automotive retail sector. Technically, the website employs modern web technologies including Google Tag Manager, Facebook Pixel, Hotjar, and Microsoft Clarity for analytics and marketing purposes. It uses the Yii PHP framework and integrates cookie consent management with granular user controls, demonstrating a mature digital infrastructure. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. From a security perspective, the website enforces HTTPS and uses CSRF tokens in forms, indicating good security hygiene. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not visibly declared and should be implemented to enhance protection. The privacy and cookie policies are comprehensive and GDPR compliant, supporting strong privacy practices. Overall, the website presents a moderate to high level of trustworthiness and security, though the WHOIS data for the www subdomain is unavailable due to domain naming rules, which slightly impacts domain registration trust analysis. The business appears legitimate and well-established, but domain registration details should be verified for full assurance.

32
100
60
85
88
2
65
usedcarscardealershipfinancebedfordshirevehiclevaluation+2 more
Google Tag ManagerFacebook PixelHotjarMicrosoft Clarity+2

Partner Domains:

www.autotrader.co.uk
partner
www.google.com
partner

+1 more partners

2026-07-01T07:20:09.977Z
citygate.co.uk favicon

Citygate

citygate.co.uk

71
TransportationUnited KingdomlargeMEDIUM

Citygate is a prominent automotive dealership in the United Kingdom specializing in Volkswagen, ŠKODA, SEAT, CUPRA, Kia, and GWM brands. With 34 locations across London and the South East, Citygate offers a comprehensive range of services including new and used car sales, servicing, MOT testing, leasing, fleet management, and rental services. The company positions itself as a leading regional dealer with a strong market presence and a focus on customer service and brand partnerships. The website reflects a professional and well-structured digital presence that caters to a broad audience of car buyers and fleet customers in the UK. Technically, the website is built using modern web technologies such as React and Gatsby, ensuring good performance and mobile optimization. It integrates several analytics and marketing tools including Google Analytics, Facebook Pixel, and Hotjar, alongside a cookie consent mechanism powered by CookiePro. The site demonstrates good SEO practices, accessibility features, and a consistent branding approach. Hosting and CMS details are not explicitly identified but the infrastructure supports a smooth user experience. From a security perspective, the website enforces HTTPS with strong SSL configuration and includes standard security headers. There is no evidence of exposed sensitive data or vulnerable libraries. However, the site lacks a dedicated security policy, vulnerability disclosure program, and incident response contact information, which are recommended for enhanced security posture. Privacy compliance is well addressed with clear privacy and cookie policies and GDPR adherence. Overall, Citygate's website is a reliable and professional platform supporting its business operations effectively. The main risk factor is the absence of WHOIS data due to a domain naming rules error, which slightly impacts trust but does not indicate malicious intent. Strategic improvements in security transparency and incident response readiness would f…

39
70
85
100
88
90
17
automotivecardealershipvolkswagenkodaseat+8 more
ReactGatsbyGoogle AnalyticsFacebook Pixel+2
2026-07-01T07:13:38.683Z