Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 24 of 151|Showing 1151-1200 of 7505
topr.pl favicon

Tatrzańskie Ochotnicze Pogotowie Ratunkowe

topr.pl

37
GovernmentPolandmediumHIGH

Tatrzańskie Ochotnicze Pogotowie Ratunkowe (TOPR) is a well-established mountain rescue organization operating primarily in the Tatra Mountains region of Poland. The website serves as an official portal providing critical safety information, emergency contact details, avalanche warnings, and weather updates to tourists, hikers, and residents. The organization is government-supported and operates as a non-profit entity, with clear disclosures of public funding and operational mandates. The site is professionally designed with consistent branding and clear navigation, targeting a general audience interested in mountain safety and rescue services. Technically, the website is built on WordPress CMS, leveraging modern frontend technologies such as Bootstrap 5, jQuery, and Swiper.js for interactive elements. Hosting is provided by cyber_Folks S.A., and the site enforces HTTPS with good SSL configuration. While performance is moderate and mobile optimization is good, there is room for improvement in accessibility and security headers implementation. The site uses Google Analytics for user tracking at a moderate level but lacks a cookie consent mechanism, which is a privacy compliance gap. From a security perspective, the site demonstrates a solid baseline with HTTPS and no visible vulnerabilities or exposed sensitive data. However, the absence of security headers and a formal security policy or incident response contact reduces the overall security posture. The WHOIS data aligns well with the business history, showing a domain age consistent with the organization's longevity and no suspicious registration patterns. Overall, the site is trustworthy and credible but could enhance compliance and security practices. The risk assessment indicates a low risk environment with no critical issues detected. Strategic recommendations include implementing security headers, adding a cookie consent banner, publishing a security policy, and conducting regular security audits to maintain and improve the security posture and privacy compliance.

-
-
-
80
52
85
-
mountainrescueemergencyservicesavalanchewarningpolandtopr+2 more
WordPressjQueryBootstrap 5FontAwesome+1

Partner Domains:

tpn.pl
partner
fundacja.topr.pl
partner

+2 more partners

2025-10-28T01:20:19.980Z
drei-quellen-mediengruppe.de favicon

Drei Quellen Mediengruppe GmbH

drei-quellen-mediengruppe.de

43
MediaGermanysmallHIGH

Drei Quellen Mediengruppe GmbH operates as a regional media and communications company based in Germany, focusing on political journalism, creative agency services, and event management. Their flagship publication, the Politikjournal Rundblick, provides insider political news and analysis for Lower Saxony. The company also offers consulting, production, post-production, marketing, and event planning services, targeting political professionals, businesses, and event clients in the region. The website reflects a small-sized business with consistent branding and professional content. Technically, the website is built on the Pimcore CMS platform and hosted by OVH, utilizing modern web technologies such as JavaScript, CSS, and FontAwesome icons. The site is mobile-optimized with good navigation and content relevance, though accessibility features are basic. Performance is moderate, and SEO optimization is basic but present. No advanced frameworks or analytics tools were detected. From a security perspective, the site uses HTTPS but lacks visible security headers and cookie consent mechanisms, indicating room for improvement in GDPR compliance and security best practices. No vulnerabilities or exposed sensitive data were found, but the absence of a security policy, incident response contacts, and vulnerability disclosure reduces the overall security maturity. WHOIS data is minimal but consistent with the hosting provider, with no suspicious patterns detected. Overall, the website is professional and trustworthy with moderate security posture and privacy compliance. Strategic improvements in security headers, cookie consent, and policy disclosures would enhance compliance and trustworthiness.

15
28
2
70
52
60
40
mediapublishingcreativeagencyeventmanagementpolitics+1 more
JavaScriptCSSHTML5FontAwesome
2025-10-28T01:15:02.530Z
S

Stadt Kaiserslautern

kaiserslautern.de

59
GovernmentGermanylargeMEDIUM

The website www.kaiserslautern.de is the official digital presence of the city of Kaiserslautern, Germany. It serves as a comprehensive portal for residents, visitors, and businesses, offering extensive information on municipal services, social programs, cultural events, tourism, education, and urban planning. The site is well-structured with clear navigation and multilingual support, reflecting a mature digital infrastructure typical of a large municipal government entity. Technically, the site is built on the Imperia CMS platform and leverages established JavaScript libraries such as jQuery, Leaflet for mapping, FontAwesome for icons, and AOS for animations. The hosting is managed via DomainControl nameservers, a common registrar service. The website demonstrates good mobile optimization, accessibility features, and SEO practices, contributing to a positive user experience. From a security perspective, the site employs HTTPS and includes cookie consent mechanisms aligned with GDPR requirements. While explicit security headers are not fully detailed, the site shows no signs of exposed sensitive data or vulnerable libraries. Analytics are handled via Piwik (Matomo), indicating a privacy-conscious approach to user tracking. However, the absence of a published security policy, incident response contacts, and vulnerability disclosure mechanisms suggests areas for improvement. Overall, the website presents a trustworthy and professional government portal with solid content quality and technical implementation. Strategic recommendations include enhancing security transparency, updating legacy libraries, and publishing formal security and incident response policies to strengthen compliance and user trust.

70
28
2
55
67
65
100
governmentmunicipalcityserviceskaiserslauterngermany+5 more
jQuery 1.11.3Leaflet.jsFontAwesomeAOS (Animate On Scroll)+1
2025-10-28T00:07:13.538Z
bildungszentrum-digital.de favicon

Bildungswerk der Erzdiözese Freiburg

bildungszentrum-digital.de

10
EducationGermanysmallCRITICAL

The Digitales Bildungszentrum website serves as a digital platform for the Bildungswerk der Erzdiözese Freiburg, focusing on adult education through online workshops and media literacy programs. It targets adults, church employees, seniors, and families, providing educational content and interactive learning opportunities. The platform consolidates regional educational offerings into a centralized online presence, enhancing accessibility and engagement. Technically, the website employs a modern frontend stack including jQuery, Bootstrap-like components, FontAwesome, and is powered by the Edith CMS backend. It uses Matomo for analytics with respect to user cookie preferences, indicating a moderate level of digital maturity. The site is mobile-optimized and structured for good SEO and accessibility, though some accessibility features could be improved. From a security perspective, the site enforces HTTPS and respects user tracking preferences, but lacks visible security headers and explicit privacy or cookie policies. No vulnerability disclosures or incident response contacts are published, which could be improved to enhance trust and compliance. The WHOIS data confirms domain legitimacy and consistency with the organization's identity. Overall, the website is professional, trustworthy, and well-positioned within its niche but would benefit from enhanced privacy compliance and security documentation to align with best practices and regulatory requirements.

-
-
-
-
-
-
-
erwachsenenbildungonlineworkshopsmedienkompetenzkirchlichebildungdigitalesbildungszentrum
jQueryjQuery UIBootstrap (implied by navbar classes)Matomo Analytics+2
2025-10-27T23:33:44.743Z
euroguidance.eu favicon

Euroguidance Network

euroguidance.eu

66
EducationLithuaniamediumMEDIUM

Euroguidance Network is a European non-profit organization focused on linking lifelong guidance and international mobility across Europe. The website serves career guidance professionals, educators, and policy makers by providing resources, events, and information related to international mobility and guidance systems. It is supported by Erasmus+ and the European Union, indicating a strong market position within the education and government sectors. The business model revolves around information dissemination, networking, and event organization. Technically, the website is built on Joomla CMS with modern frontend technologies such as Bootstrap and jQuery. It uses Google Fonts and FontAwesome for styling and icons, and integrates Google reCAPTCHA for form security. The site is mobile-optimized and has good SEO practices, though accessibility could be improved. Performance is moderate, with no major technical issues detected. From a security perspective, the site enforces HTTPS, uses CSRF tokens, and implements reCAPTCHA on forms. Cookie consent mechanisms are in place, supporting GDPR compliance. However, some security headers are missing, and no explicit security or incident response policies are published. No vulnerabilities or exposed sensitive data were detected. Overall, the website is professional, trustworthy, and compliant with privacy regulations. It lacks some advanced security documentation and direct contact details but maintains a solid security posture. Strategic recommendations include enhancing security headers, publishing security policies, and improving accessibility to further strengthen trust and compliance.

55
85
2
70
47
85
100
educationeuguidancemobilitynon-profit+2 more
Joomla CMSBootstrapjQueryFontAwesome+2
2025-10-27T23:28:18.510Z
terminusapp.com favicon

Seldon World LLC

terminusapp.com

62
TechnologyN/amediumMEDIUM

Terminus App, operated by Seldon World LLC, is a specialized SaaS platform focused on UTM governance and link management for marketing teams. The website positions the company as a provider of enterprise-grade tools to standardize and manage UTM parameters, improve campaign tracking accuracy, and replace manual spreadsheet processes. The platform targets marketing professionals and teams seeking to improve data clarity and campaign analytics. The site features comprehensive content, customer testimonials, and a SOC 2 Type 2 certification badge, indicating a commitment to security and compliance. Technically, the website employs modern JavaScript libraries including Mixpanel for analytics, Google Tag Manager, Drip for marketing automation, and QRCode.js for URL shortening features. The site is well-optimized for mobile devices, has good SEO practices, and loads quickly. However, no CMS or hosting provider details are explicitly detectable. The site uses HTTPS exclusively, ensuring secure communications. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and use of reputable third-party analytics. However, it lacks visible security headers, explicit security policies, incident response contacts, and a cookie consent mechanism, which are areas for improvement. The absence of WHOIS data for the domain is a notable concern, as it reduces transparency and trustworthiness despite the professional presentation. Overall, Terminus App presents a professional and trustworthy front for its niche market, but would benefit from enhanced transparency in domain registration and improved privacy and security disclosures to strengthen user trust and compliance posture.

30
65
17
85
42
80
100
utmbuilderutmgovernancelinkmanagementmarketingurlshortener+2 more
JavaScriptjQueryMixpanelGoogle Tag Manager+4
2025-10-27T23:05:52.504Z
ageneration.cz favicon

A+Generation

ageneration.cz

48
EnergyCzech RepublicsmallHIGH

A+Generation is a Czech-based company specializing in the design, construction, and operation of cogeneration units that produce combined heat and power using natural gas. The company operates as part of the Micronix Group, leveraging over 30 years of experience in renewable energy solutions. Their business model focuses on turnkey energy savings solutions without requiring client investment, targeting industrial and commercial energy consumers primarily in the Czech Republic. The website presents a professional image with clear service offerings and case studies demonstrating their expertise. Technically, the website is built on Drupal 8 with modern libraries such as jQuery, Slick Carousel, and Bootstrap, ensuring a responsive and user-friendly experience. While performance is moderate and mobile optimization is good, accessibility and SEO optimizations are basic. No advanced analytics or tracking tools are detected, indicating a minimal user tracking approach. From a security perspective, the site uses HTTPS (implied), but lacks visible security headers and published security policies. There is no evidence of incident response or vulnerability disclosure mechanisms. The WHOIS data is consistent with the business claims, showing domain registration in 2020 aligned with the company's founding. No WAF or blocking mechanisms are detected, and no suspicious content is present. Overall, the website is trustworthy and professional but would benefit from enhanced privacy compliance, security best practices, and transparency regarding data protection and incident response.

40
10
2
80
72
85
20
energycogenerationczechindustrialrenewable+1 more
Drupal 8jQuerySlick CarouselBlazy (lazy loading)+3

Partner Domains:

micronix.group
parent
2025-10-27T20:50:48.632Z
Z

Zentrum für Allgemeine Wissenschaftliche Weiterbildung (ZAWiW) der Universität Ulm

forschendes-lernen.de

52
EducationGermanysmallMEDIUM

The website 'Bürgerwissenschaften und Forschendes' serves as a regional platform affiliated with the Zentrum für Allgemeine Wissenschaftliche Weiterbildung (ZAWiW) at Universität Ulm. It promotes citizen science and research-based learning by facilitating community engagement in scientific projects and organizing educational events. The target audience includes citizens, researchers, and educators interested in collaborative scientific activities. The business model is non-profit and educational, focusing on community involvement and knowledge dissemination. Technically, the site is built on WordPress 6.8.3 with common plugins such as The Events Calendar and Cookie Notice. It uses Cloudflare for DNS and likely CDN services, and Matomo for privacy-conscious analytics. The site is moderately performant, mobile-optimized, and has good SEO practices. Accessibility is basic but present. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks explicit security headers and documented security policies or incident response contacts. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is consistent with the website's educational purpose and shows no suspicious registrations. Overall, the website is professional, trustworthy, and compliant with GDPR requirements. It effectively serves its educational mission with a solid technical foundation but could improve security posture by adding security headers and incident response information.

30
43
2
85
62
70
40
educationcitizenscienceresearcheventsgerman
WordPress 6.8.3PHPjQuery 3.7.1FontAwesome+3

Partner Domains:

zawiw.de
partner
2025-10-27T20:47:05.707Z
theologischer-kurs.de favicon

Institut für Pastorale Bildung der Erzdiözese Freiburg KdöR

theologischer-kurs.de

44
EducationGermanysmallHIGH

Theologischer Kurs Freiburg is an educational initiative operated by the Institut für Pastorale Bildung der Erzdiözese Freiburg, offering a specialized theological course for adults and church volunteers. The course has a strong market position as the only diocesan theological course in Germany with a 50-year history, providing foundational theological knowledge and pathways to academic qualifications such as a Bachelor in Practical Theology. The website reflects a professional and consistent brand image aligned with its religious and educational mission. Technically, the website is built on the W-Commerce CMS platform, leveraging modern JavaScript libraries like jQuery and AblePlayer, and employs Matomo for privacy-conscious analytics. The site is mobile-optimized, accessible, and performs moderately well. Hosting and DNS are managed by W-Commerce GmbH, consistent with the website's author metadata. From a security perspective, the site enforces HTTPS, implements cookie consent mechanisms, and restricts third-party content until user consent is given, demonstrating good privacy compliance. However, explicit security policies and incident response contacts are not found, representing areas for improvement. Overall, the website is trustworthy, safe, and well-suited for its target audience. Strategic recommendations include adding a security.txt file, incident response information, and enhancing security headers to further strengthen the security posture.

25
33
2
70
62
60
20
theologiestudiumerwachseneehrenamtlichtheologischerkurstheologischegrundausbildung+3 more
jQueryjQuery UIAblePlayerMatomo Analytics+3
2025-10-27T20:44:23.358Z
irp-freiburg.de favicon

Institut für Religionspädagogik der Erzdiözese Freiburg

irp-freiburg.de

43
EducationGermanysmallHIGH

The Institut für Religionspädagogik der Erzdiözese Freiburg operates as a regional educational and consulting center supporting Catholic religious education across various school types and kindergartens within the Erzdiözese Freiburg region in Germany. The website serves as an information hub offering educational materials, news, and training opportunities tailored to educators and institutions involved in religious pedagogy. The business model focuses on educational support and resource provision, positioning itself as a trusted regional institute affiliated with the Erzdiözese Freiburg. Technically, the website is built on the Edith CMS platform, utilizing modern web technologies such as jQuery, Bootstrap, and Matomo analytics for user tracking. The site is mobile-optimized with good SEO practices and accessibility basics in place. Hosting and domain management appear professional, with consistent use of web commerce services for site management. From a security perspective, the site employs HTTPS with a good SSL configuration and respects user tracking preferences by disabling analytics if the user denies consent. However, there are gaps in privacy compliance, notably the absence of explicit privacy and cookie policies, and no visible incident response or vulnerability disclosure information. Security headers are minimal, and accessibility could be improved. Overall, the website presents a low-risk profile with a solid business credibility and technical foundation but would benefit from enhanced privacy compliance and security best practices to strengthen trust and regulatory adherence.

25
33
2
70
52
60
20
religionsunterrichtreliunterrichtsmaterialschuleundreligionreligisebildung
jQueryjQuery UIMatomo Analytics Edith CMS (sesam.edith-cms.de backend)+2

Partner Domains:

irpblog.wordpress.com
partner
shop.irp-freiburg.de
partner

+1 more partners

2025-10-27T20:44:08.313Z
eintagfueruns.de favicon

Referat Ehe-Familie-Diversität im Erzbistum Freiburg

eintagfueruns.de

46
GovernmentGermanysmallHIGH

The website 'Heiraten in der Erzdiözese Freiburg' serves as an official informational platform managed by the Referat Ehe-Familie-Diversität within the Archdiocese of Freiburg. It provides comprehensive resources, event listings, and guidance for couples preparing for a church wedding, focusing on the Catholic and ecumenical communities in Germany. The site is well-positioned as a niche regional service provider with a clear target audience and a consistent brand identity aligned with the Archdiocese's mission. Technically, the website employs a modern tech stack including jQuery, Bootstrap, and the Edith CMS platform, hosted likely by w-commerce.de. It integrates Matomo analytics with privacy-conscious configurations, though it lacks a cookie consent mechanism. The site is mobile-optimized and demonstrates good SEO and accessibility practices, though some improvements in security headers and privacy compliance are recommended. From a security perspective, the site uses HTTPS with a solid SSL configuration and avoids exposing sensitive data. However, it lacks explicit security policies, incident response contacts, and vulnerability disclosure mechanisms. The WHOIS data aligns well with the website's purpose and hosting, indicating a legitimate and trustworthy domain. Overall, the website presents a low-risk profile with good business credibility and technical implementation. Strategic enhancements in privacy compliance and security best practices would further strengthen its posture.

25
33
2
70
72
60
20
hochzeitehevorbereitungkirchlichetrauungkatholischevangelisch+4 more
jQueryjQuery UIMatomo AnalyticsBootstrap (implied by navbar classes)+2

Partner Domains:

www.einfach-kirchlich-heiraten.de
partner
www.ehe-wir-heiraten.de
partner
2025-10-27T20:43:43.251Z
cellms.de favicon

escape GmbH

cellms.de

59
TechnologyGermanysmallMEDIUM

The website www.cellms.de represents escape GmbH, a German company offering the cellms® framework, a modular and comprehensive business platform solution integrating CMS, e-commerce, marketing, and business process modules. The company targets various industries including trade, manufacturing, associations, and digital agencies, positioning itself as a niche provider of complex business platform solutions. The website content is professional, well-structured, and provides clear contact information and customer testimonials, indicating a trustworthy and credible business presence. Technically, the site uses a custom proprietary CMS (cellms®) with a technology stack including jQuery 2.0.3, jQuery UI, FontAwesome, and Google Analytics for tracking. The site is mobile optimized with device detection and responsive CSS. However, some technologies are somewhat dated, and there is room for improvement in security headers and modern best practices. Performance is moderate, and SEO is adequately addressed. From a security perspective, the site uses HTTPS and implements a detailed cookie consent mechanism compliant with GDPR. No explicit security policies or incident response contacts are published, and no vulnerability disclosure or security.txt files are found. No critical vulnerabilities or suspicious content were detected. The WHOIS data is minimal but consistent with the business claims, supporting legitimacy. Overall, the website demonstrates a solid business and technical foundation with good privacy compliance and moderate security posture. Strategic improvements in security headers, incident response transparency, and modernization of the tech stack would enhance trust and resilience.

-
83
2
70
72
70
100
businessplatformcmse-commercedigitalmarketingmodularsystem+2 more
jQuery 2.0.3jQuery UI 1.10.3HTML5 Boilerplate CSSFontAwesome+2
2025-10-27T19:52:16.281Z
lernzentrum-kl.de favicon

Lernzentrum Kaiserslautern

lernzentrum-kl.de

41
EducationGermanysmallHIGH

Lernzentrum Kaiserslautern is a non-profit educational center focused on providing integration and language learning support primarily to third-country nationals residing in Kaiserslautern, Germany. The center offers free German language learning resources, open learning sessions, and exam preparation for integration and professional language tests. It is funded by the EU's Asylum, Migration and Integration Fund (AMIF) and operates under the VHS-Kaiserslautern e.V. umbrella. The website reflects a local community-oriented organization with a clear mission to facilitate integration through language competence. Technically, the website is built on WordPress 6.1.1, utilizing common plugins such as Contact Form 7 and libraries like jQuery and Owl Carousel. The site is hosted on servers associated with the rzone.de domain, indicating 1&1 IONOS hosting. The site is moderately optimized for performance and mobile devices, with a consistent branding and good user experience. However, some SEO and accessibility features are basic, and there is room for improvement in technical implementation. From a security perspective, the site uses HTTPS with good SSL configuration but lacks important security headers such as Content-Security-Policy and X-Frame-Options. No security policy or incident response information is published, and no cookie consent mechanism is present, which is a compliance gap given GDPR relevance. No vulnerabilities or exposed sensitive data were detected in the HTML content. The overall security posture is moderate but could be enhanced with standard best practices. Overall, Lernzentrum Kaiserslautern presents a trustworthy and legitimate online presence for a small educational non-profit. The site is safe, free of adult or questionable content, and provides clear contact information and social media links. Strategic recommendations include implementing cookie consent, adding security headers, publishing security and incident response policies, and maintaining regular updates to WordPress and plugins to ensure ongoing security and compliance.

-
28
2
65
67
70
20
educationintegrationlanguagelearningnon-profitgermanasaforeignlanguage
WordPress 6.1.1jQueryOwl CarouselFontAwesome+1
2025-10-27T19:49:30.879Z
hvca.hu favicon

Magyar Kockázati- és Magántőke Egyesület

hvca.hu

45
FinanceHungarysmallHIGH

The Magyar Kockázati- és Magántőke Egyesület (HVCA) is a Hungarian non-profit association representing the interests of the private equity and venture capital sector in Hungary. The organization supports its members and promotes high professional and ethical standards within the industry. The website serves as a hub for information, events, publications, and resources relevant to the Hungarian private equity ecosystem. It targets investors, advisors, and industry professionals. The association holds a leading position in the Hungarian finance sector, providing key services such as advocacy, education, and networking opportunities. Technically, the website is built on the ExpressionEngine CMS with a Foundation front-end framework, using modern web technologies including jQuery, FontAwesome, and Google Fonts. It is mobile-optimized and uses HTTPS with Google Analytics for visitor tracking. The site has good performance and SEO practices but lacks some advanced accessibility features. From a security perspective, the site enforces HTTPS and uses CSRF tokens in forms, but lacks published security policies, incident response contacts, and security headers. There is no cookie consent mechanism, which is a GDPR compliance gap. No vulnerabilities or suspicious content were detected. WHOIS data aligns well with the website's claims, indicating legitimacy. Overall, the website is professional, trustworthy, and well-maintained but could improve privacy compliance and security transparency. Strategic recommendations include implementing cookie consent, publishing security and incident response policies, and adding security headers to enhance protection and compliance.

35
10
17
60
62
75
20
financeventurecapitalprivateequitynon-profithungary+1 more
jQueryFoundation FrameworkGoogle FontsFontAwesome+1
2025-10-27T19:48:20.683Z
baw.de favicon

Bundesanstalt für Wasserbau

baw.de

64
GovernmentGermanymediumMEDIUM

The Bundesanstalt für Wasserbau (BAW) is a German federal government agency specializing in waterway engineering, infrastructure maintenance, and environmental protection related to federal waterways. It operates under the Federal Ministry for Digital and Transport (BMDV) and serves as a technical and scientific advisory body. The website reflects a well-established institution with a clear mission to support safe, efficient, and environmentally sound waterway management. The target audience includes government entities, researchers, and professionals in waterway infrastructure and environmental sectors. Technically, the website employs standard modern web technologies such as HTML5, CSS3, JavaScript, and jQuery, with additional libraries for UI enhancements like FontAwesome and BaguetteBox. The site is well-structured, mobile-optimized, and accessible, with good SEO practices. No CMS or hosting provider details are explicitly detected, suggesting a custom or government-managed platform. From a security perspective, the site uses HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and published security or incident response policies. No cookie consent mechanism was detected, which could be improved for GDPR compliance. The site shows minimal user tracking and no advertising, aligning with government standards for privacy and transparency. Overall, the website is professional, trustworthy, and well-aligned with its government agency role. Strategic recommendations include enhancing security headers, publishing security policies, and implementing cookie consent to improve compliance and security posture.

80
28
17
60
77
65
100
governmentwaterwaysengineeringresearchinfrastructure+2 more
HTML5CSS3JavaScriptjQuery+2

Partner Domains:

www.wsv.de
partner
www.bmv.de
partner

+2 more partners

2025-10-27T18:57:18.191Z
loadhog.com favicon

Loadhog Ltd

loadhog.com

62
TransportationUnited KingdommediumMEDIUM

Loadhog Ltd is a UK-based medium-sized company specializing in the design and manufacture of sustainable and reusable supply chain packaging solutions. Established in 1998, the company serves a global clientele across multiple industries including transportation, manufacturing, retail, automotive, healthcare, and waste management. Loadhog emphasizes innovation, quality, and sustainability, supported by multiple prestigious awards and certifications. Their product portfolio includes automation totes, containers, pallet lids, transport dollies, and accessories, all designed to improve logistics efficiency and reduce environmental impact. Technically, Loadhog's website is built on WordPress with modern technologies such as Gravity Forms for data collection, Weglot for multilingual support, Google reCAPTCHA for bot protection, and Google Tag Manager for analytics. Hosting is supported by Azure DNS infrastructure, ensuring reliable performance and fast loading times. The site is mobile-optimized and accessible, with good SEO practices implemented. From a security perspective, the website enforces HTTPS and uses reCAPTCHA on forms, demonstrating good security hygiene. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not detected, and there is no published security policy or incident response information. Cookie consent mechanisms are absent, which could be improved to enhance GDPR compliance. No vulnerabilities or exposed sensitive data were found. Overall, Loadhog presents a professional, trustworthy, and technically sound online presence with strong business credibility. Strategic recommendations include implementing comprehensive security headers, publishing security and incident response policies, adding cookie consent mechanisms, and considering a vulnerability disclosure policy to further strengthen security posture and compliance.

15
53
2
85
72
80
100
sustainabilityreusablepackaginglogisticssupplychainmanufacturing+3 more
WordPressGravity FormsWeglot (translation)Google reCAPTCHA v3+4
2025-10-27T17:51:53.082Z
nasjesenik.cz favicon

město Jeseník

nasjesenik.cz

60
GovernmentCzech RepublicsmallMEDIUM

The website nasjesenik.cz serves as the official digital presence for the city of Jeseník in the Czech Republic. It provides residents and visitors with information about city projects, news updates, strategic plans, and public services. The site is well-branded with consistent city logos and offers a user-friendly experience with clear navigation and search functionality. The target audience primarily includes local residents and stakeholders interested in municipal developments. Technically, the site employs modern web technologies including HTML5, CSS3, JavaScript, Google Analytics, Google Tag Manager, and Mapbox for interactive maps. Hosting and DNS are managed via Cloudflare, ensuring good performance and security. The site is mobile-optimized and includes cookie consent mechanisms, reflecting a moderate level of digital maturity. From a security perspective, the site enforces HTTPS and integrates consent management for analytics. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not evident, and there is no published security policy or incident response contact. No vulnerabilities or sensitive data exposures were detected in the analyzed content. Privacy compliance is partial, with cookie consent present but no visible privacy or terms of service pages. Overall, the website is trustworthy and professional, suitable for a municipal government entity. Strategic recommendations include publishing comprehensive privacy and terms of service documents, enhancing security headers, and providing clear contact information for security incidents to improve compliance and user trust.

15
73
17
60
57
75
100
governmentmunicipalcityprojectsnews+2 more
HTML5CSS3JavaScriptGoogle Analytics+5
2025-10-27T15:27:30.032Z