Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 115 of 145|Showing 5701-5750 of 7213
gamblingcare.ie favicon

Gambling Awareness Trust

gamblingcare.ie

60
Non-profitIrelandsmallMEDIUM

GamblingCare.ie is a non-profit website operated by the Gambling Awareness Trust, focused on providing support, education, and resources for individuals affected by problem gambling in Ireland. Established in 2019, the organization offers a range of services including helpline support, online and in-person counseling referrals, group support, and educational training. The website serves as a central hub for information and access to treatment options, funded by donations from the betting and gaming industry in Ireland. Technically, the website is built on WordPress using Elementor and several plugins for enhanced functionality, including event calendars and social media integration. It employs modern tracking and marketing tools such as Google Tag Manager and Facebook Pixel, indicating a moderate level of digital maturity. The site is hosted with a reputable Irish registrar and uses Cloudflare DNS, though DNSSEC is not enabled. From a security perspective, the site uses HTTPS and avoids exposing sensitive data, but lacks advanced security headers and formal security policies. Privacy compliance is weak due to the absence of explicit privacy and cookie policies or consent mechanisms. Contact information is limited but includes a national helpline number and a contact form. Social media presence is robust, supporting community engagement and outreach. Overall, GamblingCare.ie presents a professional and trustworthy resource for gambling addiction support in Ireland, with room for improvement in privacy compliance and security hardening to enhance user trust and regulatory adherence.

15
68
17
70
65
60
100
gamblingaddictionsupportirelandnon-profit+2 more
WordPressElementorjQueryGoogle Tag Manager+3
2025-07-05T23:40:56.982Z
sportgenerate.com favicon

SportGenerate

sportgenerate.com

59
TechnologyN/asmallMEDIUM

SportGenerate is a specialized technology company focused on delivering innovative iGaming solutions including Odds Feed, Esports, and Live Gaming products. Their offerings include proprietary betting content from professional tournaments branded as Rocket Masters Cup and Cyber Masters, targeting iGaming operators and sports betting companies. The company appears to be a small-sized business founded in 2020, with a consistent and professional online presence. Technically, the website is built on WordPress using Elementor and WooCommerce, leveraging Cloudflare for DNS and CDN services. The site employs modern JavaScript libraries such as jQuery and Swiper.js for interactive features. Performance and mobile optimization are good, though accessibility features are basic. The site integrates multiple marketing and tracking tools including Google Tag Manager, Facebook Pixel, LinkedIn Insight, and Zoho SalesIQ, indicating moderate user tracking. From a security perspective, the site uses HTTPS with a valid SSL configuration and has domain transfer protections in place. However, it lacks DNSSEC and standard security headers, which are recommended for enhanced security. No explicit privacy, cookie, or terms of service policies were found, which is a compliance gap. Incident response and vulnerability disclosure information are also absent. Overall, the website is professional and trustworthy with moderate security posture but requires improvements in privacy compliance and security best practices to reduce risk and enhance user trust.

35
35
2
85
57
80
100
igamingesportslivegamingoddsfeedsportsbetting+1 more
jQuerySwiper.jsWooCommerceElementor+1

Partner Domains:

stats.sportgenerate.com
partner
2025-07-05T20:14:57.426Z
shiprelax.com favicon

ShipRelax

shiprelax.com

46
TransportationUnited StatessmallHIGH

ShipRelax is a specialized third-party logistics (3PL) provider focused on cross-border e-commerce fulfillment. The company offers a global warehouse network, smart shipping solutions, branded packaging, and return logistics services to help e-commerce businesses expand internationally with lower shipping costs and faster deliveries. Their platform integrates with multiple sales channels, providing real-time visibility and analytics. The website positions ShipRelax as a reliable partner for global e-commerce growth, targeting small to medium-sized online retailers. Technically, the website is built on WordPress using Elementor and Yoast SEO, with modern front-end technologies like jQuery and FontAwesome. It is hosted likely via GoDaddy, with SSL enabled and Google Analytics integrated for tracking. The site is mobile-optimized and demonstrates good SEO practices, though some accessibility features could be improved. From a security perspective, the site uses HTTPS and domain registration protections but lacks advanced security headers and published security policies. No cookie consent mechanism or GDPR compliance indicators are present, which could be improved. No vulnerabilities or exposed sensitive data were detected. The domain registration is transparent and consistent with the business profile. Overall, ShipRelax presents a professional and trustworthy online presence with solid business credibility and technical implementation. Strategic improvements in privacy compliance and security policies would enhance trust and regulatory adherence.

15
53
2
70
72
75
-
3ple-commercefulfillmentlogisticscross-border+2 more
WordPressElementorYoast SEOjQuery+3
2025-07-05T16:53:52.617Z
kmkventures.com favicon

KMK Ventures Private Limited

kmkventures.com

70
FinanceUnited StateslargeMEDIUM

KMK Ventures Private Limited is a well-established outsourced accounting and US taxation firm founded in 2020, targeting US-based businesses including CPA firms, startups, and mid-market companies. The company offers a comprehensive suite of accounting, tax, audit, advisory, and automation services, positioning itself as a leading provider in the finance sector with a large team of over 800 professionals. Their business model focuses on providing cost-effective, experienced, and secure back-office financial solutions leveraging technology and automation. The website reflects a professional and consistent brand image with clear navigation and rich content tailored to their target audience. Technically, the website is built on WordPress using Elementor and integrates modern tools such as Google Tag Manager, Microsoft Clarity, and Tawk.to for analytics and user engagement. The site is mobile-optimized, SEO-friendly, and performs moderately well. Security posture is solid with HTTPS enforced and ISO/IEC 27001:2013 certification, though improvements such as enabling DNSSEC and publishing incident response information are recommended. Overall, KMK Ventures demonstrates a strong security culture and business credibility with transparent contact information and trust indicators. The website is safe for general audiences with no adult or questionable content. Strategic recommendations include enhancing privacy compliance with cookie consent, improving DNS security, and formalizing vulnerability disclosure and incident response processes to further strengthen trust and compliance.

35
35
47
85
85
90
100
accountingtaxservicesoutsourcingcpafirmsfinance+1 more
WordPressElementorSlider RevolutionjQuery+6
2025-07-05T16:53:42.585Z
R

Regionalpedias

regionalpedias.com

60
TechnologyN/asmallMEDIUM

Regionalpedias is a newly launched content website established in 2024, focusing on technology, biographies, news, and gaming content. The site targets a general audience interested in trending and informative articles within these domains. The business model centers on content publishing, leveraging WordPress and Elementor for content management and presentation. The website demonstrates good design quality, mobile optimization, and clear navigation, positioning itself as a niche content provider in the technology and biography sectors. From a technical perspective, the website uses a modern CMS platform (WordPress) with Elementor page builder and LiteSpeed Cache for performance optimization. The hosting and domain registration are managed via NameCheap, with no privacy protection on WHOIS data, indicating transparency. Performance is moderate with good mobile responsiveness, though accessibility features are basic. SEO optimization is adequate with proper meta tags and structured data. Security posture is basic; HTTPS is enabled, but no DNSSEC or security headers are implemented, which could expose the site to certain risks. No advanced security policies or incident response information is published, and no cookie consent mechanism is present, which may impact GDPR compliance. Contact information is limited to a contact form, with no explicit emails or phone numbers provided. Overall, the website is functional and professionally presented but would benefit from enhanced security measures, privacy compliance improvements, and more transparent contact information to increase trust and compliance. Strategic recommendations include implementing DNSSEC, security headers, cookie consent, and publishing security and incident response policies.

30
53
2
70
80
75
100
technologybiographynewsgamescontent
WordPressElementorLiteSpeed CachejQuery
2025-07-05T16:53:16.330Z
whipwashersmobiledetailing.com favicon

Whip Washers Mobile Detailing

whipwashersmobiledetailing.com

61
TransportationUnited StatessmallMEDIUM

Whip Washers Mobile Detailing is a specialized mobile auto detailing service operating in New Jersey, offering premium services such as ceramic coatings, paint correction, and headlight restoration. The company positions itself as the leading mobile detailing provider in the region, targeting vehicle owners seeking convenient and high-quality car care solutions. The website reflects a small-sized business founded in 2022 with a clear focus on service excellence and customer engagement through multiple social media channels. Technically, the website is built on WordPress using the Elementor page builder and Astra theme, integrating modern web technologies and analytics tools like Google Analytics and Google Tag Manager. The site is mobile-optimized and SEO-friendly, though performance is moderate and accessibility features are basic. Hosting details are not explicitly stated, but the domain is registered with GoDaddy and uses Cloudflare DNS. From a security perspective, the site employs HTTPS and domain status protections but lacks DNSSEC and important security headers. There is no visible privacy policy, cookie consent mechanism, or incident response information, which are notable compliance gaps. No vulnerabilities or suspicious activities were detected in the content or scripts. The domain registration data is consistent and transparent, supporting the legitimacy of the business. Overall, the website presents a professional and trustworthy front for a small service business but would benefit from enhanced privacy compliance and security hardening to improve user trust and regulatory adherence.

15
58
17
70
75
75
100
autodetailingmobiledetailingceramiccoatingpaintcorrectionheadlightrestoration+2 more
WordPressElementorAstra ThemejQuery+3
2025-07-05T16:52:46.189Z
slotenmakerapeldoorn.com favicon

Slotenmaker Apeldoorn

slotenmakerapeldoorn.com

45
Real EstateNetherlandssmallHIGH

Slotenmaker Apeldoorn is a local locksmith service provider based in Apeldoorn, Netherlands, established in 2019. The company offers a range of locksmith services including emergency lock opening, lock replacement, burglary protection, and installation of advanced locking systems such as multi-point locks and core pull protection. The business positions itself as a fast, reliable, and certified locksmith service with multiple local locations ensuring rapid response times. The website reflects a professional and consistent brand image with clear contact details and customer trust signals such as high review ratings and SKG certification. Technically, the website is built on WordPress using the Elementor framework, hosted on SiteGround. It employs modern tracking tools like Google Analytics and Google Tag Manager, and implements a cookie consent mechanism indicating GDPR awareness. The site is mobile-optimized and SEO-friendly, though some accessibility features are basic. Security posture is moderate with HTTPS enabled but lacks advanced security headers and a published privacy policy or terms of service, which are compliance gaps. Overall, the security posture is adequate for a small local business but could be improved by implementing security headers, publishing privacy and terms documents, and enabling DNSSEC. No WAF or content blocking mechanisms were detected, and no vulnerabilities or suspicious patterns were found in the WHOIS data. The domain registration is consistent with the business claims and shows no signs of suspicious activity. Strategic recommendations include enhancing security headers, publishing comprehensive privacy and terms policies, adding a security.txt file for vulnerability disclosure, and continuing to maintain transparent and accessible contact information to strengthen trust and compliance.

15
50
17
70
62
65
-
locksmithapeldoornsecurityemergencyserviceskgcertified+3 more
WordPressElementorGoogle AnalyticsGoogle Tag Manager+1
2025-07-05T15:40:52.198Z
C

CouponCodeBox

couponcodebox.com

37
E-commerceN/asmallHIGH

CouponCodeBox is an online coupon aggregator platform offering thousands of verified promo codes and discounts for a wide range of popular online stores. The website targets online shoppers seeking to save money through verified coupons and discount offers. The business model is primarily affiliate marketing, earning commissions through referrals to partner retail sites. The platform positions itself as a reliable source for daily updated coupon codes, catering to a general audience of online consumers. Technically, the website is built on WordPress using the Elementor page builder and Rank Math SEO plugin, indicating a modern CMS infrastructure with SEO optimization. It leverages external CDNs such as Cloudfront and integrates advertising and affiliate marketing scripts from Sovrn and VigLink. The site demonstrates good mobile optimization and clear navigation, though accessibility features are basic. From a security perspective, the website uses HTTPS and does not expose sensitive data in the HTML content. However, no explicit security headers or policies are detected, and there is a lack of privacy and cookie policies, which are critical for compliance and user trust. The absence of WHOIS data raises concerns about domain legitimacy and ownership transparency, which impacts overall trustworthiness. Overall, CouponCodeBox presents a professional and content-rich platform for coupon aggregation but requires improvements in privacy compliance, security best practices, and domain registration transparency to enhance its security posture and business credibility.

20
53
2
75
-
75
-
couponspromocodesdiscountse-commerceaffiliatemarketing
jQueryElementorWordPressRank Math SEO+3
2025-07-05T14:30:28.188Z
yourescortweb.com favicon

Your Escort Website

yourescortweb.com

66
OtherSpainsmallMEDIUM

Your Escort Website is a specialized digital marketing and website design agency catering to escorts, adult industry workers, and models. The company focuses on creating high-quality, aesthetically appealing websites that enhance the personal brand and digital presence of its clients. Operating from Madrid, Spain, and founded in 2023, the business positions itself as a niche service provider within the adult services sector, offering branding, marketing, SEO, and web design tailored to the unique needs of adult industry professionals. Technically, the website is built on WordPress using the Astra theme and Elementor page builder, supplemented by SEO and multilingual plugins such as Rank Math and TranslatePress. The site is hosted behind Cloudflare DNS, ensuring performance and security benefits. The design is professional, mobile-optimized, and SEO-friendly, though accessibility features are basic. The site employs HTTPS with a good SSL configuration but lacks some advanced security headers and explicit security policies. From a security perspective, the site demonstrates good baseline practices such as HTTPS and domain transfer protection but lacks published security policies, incident response contacts, and vulnerability disclosure mechanisms. No WAF or blocking mechanisms were detected, and no vulnerabilities were apparent in the analyzed content. Privacy compliance is partial, with a cookie consent mechanism present but no visible privacy or terms of service policies. Overall, the website is a credible and professional platform for its niche market, with moderate security and privacy compliance. Strategic improvements in privacy documentation, security headers, and incident response transparency would enhance trust and compliance posture.

35
80
17
60
75
80
100
escortadultserviceswebsitedesignmarketingseo+1 more
WordPressAstra ThemeElementorRank Math SEO+2
2025-07-05T14:28:52.801Z
ibpaworld.org favicon

International Bullying Prevention Association

ibpaworld.org

50
Non-profitUnited StatessmallMEDIUM

The International Bullying Prevention Association (IBPA) is a US-based non-profit organization dedicated to providing evidence-based bullying prevention resources, education, and research dissemination. Established since 2003, the organization maintains a professional website offering resources for schools, families, and communities, and promotes events such as the World Anti-Bullying Forum. The website serves as a hub for educational materials, webinars, and the International Journal of Bullying Prevention, positioning IBPA as a recognized entity in the bullying prevention field. Technically, the website is built on WordPress using the Elementor page builder and Astra theme, integrating modern web technologies and analytics tools including Google Analytics, Google Tag Manager, and Facebook Pixel. The site demonstrates good mobile optimization, SEO practices, and moderate performance. Hosting is inferred to be with GoDaddy, consistent with the domain registrar information. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks advanced security headers and published security policies. The domain WHOIS is privacy protected, which is common and justified for non-profits. No critical vulnerabilities or exposed sensitive data were detected. Cookie consent mechanisms are in place, but no explicit privacy policy or terms of service pages were found. Overall, IBPA's website is professional, trustworthy, and safe for general audiences. Strategic improvements include publishing comprehensive privacy and security policies, enabling DNSSEC, and enhancing security headers to strengthen the security posture and compliance. These steps will improve user trust and regulatory adherence.

15
68
17
70
72
75
-
bullyingpreventionnon-profiteducationresearchresources+3 more
WordPressElementorAstra ThemeGoogle Tag Manager+3

Partner Domains:

starsnashville.kindful.com
partner
worldantibullyingforum.com
partner
2025-07-05T11:05:14.844Z