Skip to main content

Finance security reports

Browse 5,578 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

156451
Websites
130
Industries
113
Countries
52
Avg Score
Page 96 of 112|Showing 4751-4800 of 5578
chetcuticauchi.com favicon

ACC Advisors Ltd.

chetcuticauchi.com

57
FinanceMaltamediumMEDIUM

CCLEX is a well-established global firm specializing in investment migration law and tax advisory services, focusing on citizenship and residence by investment programs. The company holds a strong market position supported by multiple industry awards and certifications, targeting high net worth individuals seeking global mobility and tax planning solutions. The website reflects a professional and comprehensive presentation of their services, with clear navigation and multilingual support. Technically, the website is built on a Kentico CMS platform using ASP.NET Web Forms, with integration of common marketing and analytics tools such as Google Analytics, Facebook Pixel, Hotjar, and LinkedIn Insight Tag. The site employs Cookiebot for cookie consent management, ensuring GDPR compliance. While the technology stack includes some dated components like jQuery 1.12, the overall infrastructure supports good performance and mobile optimization. From a security perspective, the site enforces HTTPS and uses CAPTCHA on contact forms, with several security headers present. However, there is room for improvement by adding advanced headers like Content-Security-Policy and Strict-Transport-Security. No critical vulnerabilities or exposed sensitive data were detected. Privacy policies and cookie consent mechanisms are comprehensive and transparent, supporting strong privacy compliance. Overall, CCLEX demonstrates a mature digital presence with strong business credibility and trust indicators. The security posture is solid but could be enhanced with additional measures. The website effectively supports the company’s business goals and compliance requirements.

35
58
5
85
-
85
100
investmentmigrationcitizenshipbyinvestmentresidencebyinvestmentlegalservicestaxadvisory+2 more
jQuery 1.12.0BootstrapFont Awesome 4.7.0Cookiebot+4
2025-06-21T18:21:55.251Z
V

Vincent Curmi & Associates

vca.com.mt

43
FinanceMaltasmallHIGH

Vincent Curmi & Associates (VCA) is a boutique accounting and consulting firm based in Malta with over 45 years of experience. The company offers a range of services including audit and assurance, corporate services, back office support, and tax compliance. Their business model focuses on personalized client relationships and tailored service delivery, targeting businesses and individuals operating in or with interests in Malta. The website reflects a professional and consistent brand presence with clear navigation and relevant content for their audience. Technically, the website is built on ASP.NET WebForms with legacy JavaScript libraries such as jQuery 1.7.1 and Modernizr 2.0.6. It integrates social media SDKs and Google Analytics for marketing and tracking purposes. The site shows moderate performance and basic mobile optimization but lacks modern security headers and HTTPS enforcement, which are critical for protecting user data and maintaining trust. From a security perspective, the absence of HTTPS and use of outdated libraries present significant vulnerabilities. No explicit security policies, incident response contacts, or data protection officer information are published, indicating gaps in compliance and security maturity. The website does provide clear contact information and links to reputable Maltese regulatory bodies, supporting its legitimacy. Overall, while the business credibility and content quality are good, the technical and security posture require urgent improvements to meet modern standards and regulatory compliance. Strategic enhancements in SSL implementation, library updates, and privacy mechanisms are recommended to reduce risk and enhance user trust.

15
3
5
70
-
80
100
accountingaudittaxcorporateservicesmalta+2 more
jQuery 1.7.1Modernizr 2.0.6ASP.NET WebFormsFacebook SDK+1
2025-06-21T18:21:55.246Z
starlimited.co.uk favicon

ST&R Limited

starlimited.co.uk

44
FinanceUnited KingdomsmallHIGH

ST&R Limited is a UK-based independent insurance broker authorized by the Financial Conduct Authority (FCA). The company offers a range of insurance products including life, home, health, critical illness, income protection, and specialized policies for over 45s. Positioned as a customer-centric broker, ST&R emphasizes personalized advice and competitive insurance solutions. The website reflects a professional and consistent brand image with clear navigation and relevant content targeting individuals and businesses seeking insurance coverage in the UK. Technically, the website is built on WordPress using Elementor, with integrations for SEO (Yoast), analytics (Google Analytics, Facebook Pixel), and customer reviews (Trustpilot). The site is mobile-optimized and performs moderately well, with good SEO practices and basic accessibility features. Security posture is adequate with HTTPS enforced and form validation implemented, though there is room for improvement in security headers and published security policies. Overall, the security posture is solid with no critical vulnerabilities detected. Privacy compliance is supported by a clear privacy policy and cookie consent mechanism, though explicit incident response and vulnerability disclosure policies are absent. The domain WHOIS data aligns with the business claims, indicating legitimacy and consistency. Strategic recommendations include enhancing security headers, publishing security and incident response policies, and improving accessibility compliance to further strengthen trust and compliance.

15
28
-
70
-
60
100
insurancefcaapprovedlifeinsurancehomeinsurancehealthinsurance+3 more
WordPressElementorjQueryYoast SEO+2
2025-06-21T18:21:55.061Z
C

Central Bank of Malta

centralbankmalta.org

58
FinanceMaltamediumMEDIUM

The Central Bank of Malta operates as the national central bank responsible for implementing monetary policy, ensuring financial stability, overseeing payment systems, issuing currency, and conducting economic research. The website reflects its authoritative position with comprehensive content targeting the general public, financial institutions, and government entities. It offers a range of services including publications, market data, and regulatory information, positioning itself as a key financial institution in Malta. Technically, the website is built on an ASP.NET WebForms platform with modern JavaScript libraries such as jQuery 3.6. It integrates third-party services like Cookiebot for cookie consent management, Google Analytics, and Hotjar for analytics and user behavior tracking. The site demonstrates moderate performance and basic mobile optimization, with room for improvement in accessibility and security headers. From a security perspective, the site enforces HTTPS and employs a robust cookie consent mechanism with blocking mode to comply with GDPR. No critical vulnerabilities or exposed sensitive data were detected. However, additional security headers could enhance protection. Privacy compliance is strong, with clear policies and user consent management. Overall, the Central Bank of Malta's website is a professional, trustworthy, and compliant digital presence that effectively supports its institutional role. Strategic improvements in security headers, mobile optimization, and accessibility would further strengthen its posture.

75
58
5
75
-
65
100
centralbankmaltafinancemonetarypolicyeconomicresearch+3 more
ASP.NET WebFormsjQuery 3.6CookiebotGoogle Analytics+1
2025-06-21T18:21:54.998Z
arqgroup.com favicon

ARQ

arqgroup.com

45
FinanceMaltamediumHIGH

ARQ Group is a Malta-based professional services organization specializing in corporate advisory, tax, compliance, licensing, accounting, and investment migration services. With over 20 years of experience, ARQ positions itself as a comprehensive partner for businesses seeking to establish and grow in Malta, particularly in sectors such as financial services and iGaming. The website reflects a mature business with a clear market position and a broad service offering tailored to local and international clients. Technically, the website is built on WordPress using the Divi theme, incorporating modern JavaScript libraries and Google Tag Manager for analytics. The site demonstrates good SEO practices, mobile optimization, and a professional design, although accessibility features could be enhanced. Performance is moderate, with no critical technical issues detected. From a security perspective, the site enforces HTTPS and includes some security headers, with no exposed sensitive data or vulnerable libraries identified. However, it lacks a visible cookie consent mechanism and published security or incident response policies, which are recommended for compliance and trust. The domain registration data aligns well with the business claims, indicating a legitimate and established entity. Overall, ARQ Group's website presents a professional and trustworthy digital presence with minor areas for improvement in privacy compliance and security transparency.

60
40
5
85
-
85
-
corporateservicesadvisorytaxcompliancemalta+3 more
WordPressDivi ThemejQueryMediaElement.js+1

Partner Domains:

arqeducate.com
partner
ofion.mt
partner
2025-06-21T18:21:54.989Z
blevinsfranks.com favicon

Blevins Franks

blevinsfranks.com

50
FinanceUnited KingdomlargeMEDIUM

Blevins Franks is a well-established financial advisory firm specializing in cross-border tax, wealth management, pensions, investments, and estate planning services primarily targeting British expatriates living in Europe. With over 50 years of experience and multiple offices across Europe and the UK, the company holds a strong market position as a leading adviser for UK nationals abroad. Their business model focuses on personalized financial planning and advisory services, supported by a comprehensive digital presence and strong regulatory compliance across jurisdictions including the UK, Malta, and France. Technically, the website is built on a modern WordPress CMS platform with WooCommerce integration, leveraging popular libraries such as jQuery and FontAwesome. It employs Google Analytics, Facebook Pixel, and Google Tag Manager for marketing and analytics purposes, alongside a cookie consent management system to ensure GDPR compliance. The site demonstrates good mobile optimization, SEO practices, and user experience design, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS and uses standard WordPress security practices, though explicit security headers are not clearly detected and could be improved. No critical vulnerabilities or exposed sensitive data were found. Privacy compliance is strong with clear privacy and cookie policies, and contact information is readily available. However, the absence of an incident response contact or vulnerability disclosure policy suggests room for enhancement in security transparency. Overall, Blevins Franks presents a trustworthy, professional, and compliant online presence with a solid business foundation. Strategic recommendations include enhancing security headers, publishing incident response and vulnerability disclosure information, and further improving accessibility features to maintain high standards in security and compliance.

35
33
5
60
-
80
100
financetaxplanningwealthmanagementexpatriatescross-border+3 more
WordPress 6.8.1WooCommerce 9.8.5jQuery 3.7.1FontAwesome 5.15.3+4
2025-06-21T18:21:54.747Z
kidstart.co.uk favicon

KidStart Limited

kidstart.co.uk

54
FinanceUnited KingdommediumMEDIUM

KidStart Limited operates a UK-based cashback platform designed to help families save money for their children by earning cashback on everyday online purchases from a wide range of partner retailers. The website is well-branded and targets parents, grandparents, and family members interested in building savings for children. The business model leverages affiliate partnerships with major retailers and financial services, including a Junior ISA offering. The site demonstrates a solid market position with visible trust indicators such as FCA authorization and customer testimonials. Technically, the website uses a traditional tech stack including jQuery, Font Awesome, Facebook SDK, and Google Analytics. While the site is mobile-optimized and has good SEO practices, some technical debt is evident with the use of an older jQuery version and lack of modern security headers. Performance is moderate, and accessibility is basic but functional. From a security perspective, the site enforces HTTPS and integrates secure Facebook OAuth login flows. However, it lacks explicit security headers and uses an outdated JavaScript library version, which could expose it to vulnerabilities. Privacy compliance is strong with clear privacy and cookie policies and GDPR indicators. No direct contact emails or phone numbers are provided on the main pages, which may affect user trust slightly. Overall, KidStart presents a trustworthy and professional online presence with a good balance of business credibility and privacy compliance. Security posture is adequate but could be improved by updating libraries and adding security headers. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic improvements in security and contact transparency would enhance trust and resilience.

55
43
-
85
-
70
100
cashbackchildrensavingsfamilyfinanceshoppinguk+2 more
jQuery 1.10.1Font AwesomeFacebook SDKGoogle Analytics+2

Partner Domains:

beanstalkapp.co.uk
partner
smart.link
partner
2025-06-21T18:21:54.663Z
revisorn.com favicon

Account AB

revisorn.com

45
FinanceSwedenmediumHIGH

Account AB is a well-established Swedish accounting and business advisory firm based in Mölndal, serving a broad range of clients from small businesses to large corporate groups. Founded in 1988, the company offers comprehensive services including bookkeeping, annual reports, consolidated accounting, tax advisory, and administrative support. Their market position is strengthened by certifications such as SRF Auktoriserad redovisningskonsult and membership in SRF Konsulterna, reflecting professionalism and trustworthiness. The website is professionally designed with clear navigation and bilingual support (Swedish and English), targeting local businesses seeking reliable financial services. Technically, the website is built on WordPress using Elementor and Yoast SEO, indicating a modern and maintainable infrastructure. Performance is moderate with good mobile optimization and basic accessibility features. SEO practices are well implemented, enhancing discoverability. Security posture is solid with HTTPS enforced and no exposed sensitive data, although the absence of security headers and vulnerability disclosure pages suggests room for improvement. Overall, the security posture is good but could be enhanced by implementing cookie consent mechanisms, security headers, and incident response information. The domain registration details align well with the business claims, supporting legitimacy. No WAF or blocking mechanisms were detected, allowing full content access and analysis. Strategically, Account AB should focus on enhancing privacy compliance and security transparency to further build client trust and meet evolving regulatory requirements.

15
25
5
70
-
60
100
accountingfinanceconsultingredovisningskatterdgivning+1 more
WordPressElementorYoast SEOjQuery+3
2025-06-18T08:56:12.725Z
merituscapital.com favicon

Meritus Capital

merituscapital.com

55
FinanceUnited StatesmediumMEDIUM

Meritus Capital is a specialized financial services company offering tailored factoring and payroll funding solutions primarily targeting staffing agencies, manufacturing, transportation, B2B companies, and startups. With over 25 years of experience and a strong client base, the company positions itself as a trusted partner enabling businesses to improve cash flow, reduce financing costs, and support growth without incurring debt. The website is professionally designed, mobile-optimized, and rich in relevant content including detailed case studies and team bios, enhancing user trust and engagement. Technically, the site leverages modern technologies such as Webflow CMS, jQuery, Slick Carousel, and Cloudflare services including Turnstile CAPTCHA for form security. The infrastructure supports fast loading times and good accessibility standards. Security posture is strong with HTTPS enforced, appropriate security headers, and secure form handling. However, the site lacks a visible cookie consent mechanism and explicit security or incident response policies, which are areas for improvement. Overall, the domain registration data aligns well with the business claims, indicating legitimacy and consistency. The company maintains an active social media presence across LinkedIn, YouTube, Facebook, and TikTok, further supporting its market credibility. The site’s privacy policy is present but basic, and GDPR compliance indicators are minimal. Strategic recommendations include enhancing privacy compliance with cookie consent, publishing terms of service and security policies, and continuous monitoring of third-party scripts for vulnerabilities.

60
28
13
75
-
80
100
factoringpayrollfundinginvoicefactoringfinancialservicesbusinessfinancing+3 more
WebflowjQuerySlick CarouselGoogle Tag Manager+1
2025-06-18T08:56:12.456Z
msci.com favicon

MSCI Inc.

msci.com

60
FinanceUnited StatesenterpriseMEDIUM

MSCI Inc. is a leading global provider of data, analytics, and technology solutions designed to support investment decision-making across private assets, wealth management, sustainability, indexes, and risk management. The company targets investment professionals and asset managers, offering integrated tools and insights to enhance portfolio performance and risk assessment. MSCI maintains a strong market position with a comprehensive suite of services and a professional, user-friendly website that reflects its enterprise-level stature. Technically, the website leverages modern frameworks such as React and Next.js, with integrations for analytics and consent management including Google Tag Manager and OneTrust. The site demonstrates excellent performance, mobile optimization, and accessibility, supported by a robust content management system likely based on Adobe Experience Manager. Security best practices are observed with HTTPS enforcement, security headers, and no visible vulnerabilities. The security posture is strong, though explicit security policies and incident response contacts are not publicly detailed. Privacy compliance is well-managed with clear privacy and cookie policies and consent mechanisms. The website exhibits high professionalism and trustworthiness, supported by consistent branding and legal disclosures. Overall, MSCI's digital presence is mature and secure, supporting its business credibility and market leadership. Strategic recommendations include publishing detailed security policies and incident response information to further enhance transparency and trust.

50
63
5
85
-
85
100
sustainabilityprivateassetswealthriskclimate+3 more
ReactNext.jsGoogle Tag ManagerOneTrust+3
2025-06-18T08:56:10.774Z
spk.gov.tr favicon

Sermaye Piyasası Kurulu

spk.gov.tr

40
FinanceTurkeylargeHIGH

Sermaye Piyasası Kurulu (SPK) is the official Capital Markets Board of Turkey, serving as the primary regulatory authority overseeing capital markets, investment firms, and financial instruments within the country. The website provides comprehensive information and services targeted at investors, companies, and financial institutions, including regulatory frameworks, bulletins, licensing exams, and investor education. The site is well-branded, consistent, and professionally maintained, reflecting its authoritative government status. Technically, the website employs modern web technologies such as HTML5, CSS3, JavaScript libraries including Swiper.js for carousels and Tobii.js for lightbox functionality, and integrates Google Fonts and Google Tag Manager for analytics. The site is mobile-optimized with good navigation and SEO practices, although accessibility features could be enhanced. From a security perspective, the site enforces HTTPS with an excellent SSL configuration and follows best practices like opening external links in new tabs and avoiding exposed sensitive data. However, it lacks explicit security policies, incident response contacts, and a cookie consent mechanism, which are areas for improvement to enhance compliance and user trust. Overall, the website is a credible and authoritative source for capital market regulation in Turkey, with a strong business credibility score and good technical implementation. Strategic recommendations include adding privacy and security policy pages, implementing cookie consent, and enhancing accessibility and security headers to further strengthen the site's security posture and compliance.

-
10
-
60
-
65
100
financegovernmentcapitalmarketsregulationinvestorprotection+1 more
HTML5CSS3JavaScriptSwiper.js (carousel)+3

Partner Domains:

kap.org.tr
partner
tefas.gov.tr
partner

+2 more partners

2025-06-18T08:56:09.439Z
pbab.se favicon

PBAB Redovisning och Revision

pbab.se

48
FinanceSwedensmallHIGH

PBAB Redovisning och Revision is a well-established Swedish accounting and auditing firm with over 50 years of experience. The company offers a broad range of financial services including accounting, auditing, tax advisory, company formation, and digital administration, targeting entrepreneurs and businesses across Sweden. Their business model includes both fixed-price and hourly billing, with subscription packages tailored to client needs. The firm emphasizes digital modernization and client education, positioning itself as a modern, trusted partner in the finance sector. Technically, the website is built on WordPress with modern plugins and frameworks such as Bootstrap and jQuery. It demonstrates good mobile optimization and SEO practices, though some accessibility features could be enhanced. The site uses HTTPS and a GDPR-compliant cookie consent mechanism, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS and employs cookie consent best practices. However, it lacks explicit security headers and published security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The WHOIS data aligns well with the business claims, supporting legitimacy. Overall, the website presents a professional and trustworthy image with good privacy compliance and a solid technical foundation. Strategic improvements in security headers and incident response transparency would further strengthen the security posture and trustworthiness.

15
55
5
70
-
60
100
accountingauditingconsultingdigitalizationgdpr+3 more
WordPress 6.8.1jQuery 3.7.1Bootstrap 3.xPHP (implied by WordPress)+1

Partner Domains:

far.se
partner
soliditet.se
partner

+2 more partners

2025-06-18T08:56:04.716Z
dtcc.com favicon

The Depository Trust and Clearing Corporation (DTCC)

dtcc.com

59
FinanceUnited StatesenterpriseMEDIUM

The Depository Trust and Clearing Corporation (DTCC) is a leading global financial market infrastructure provider specializing in post-trade services such as clearing, settlement, and data services. The website reflects a mature enterprise with a comprehensive portfolio of financial services targeting institutional clients and market participants. The company is positioned as a critical backbone in the financial ecosystem, offering a wide range of services including digital asset platforms and consulting services. The technical infrastructure is robust, leveraging modern JavaScript libraries, Adobe Experience Platform, and integrated marketing tools like Marketo and OneTrust for compliance and user engagement. The site is well-optimized for mobile and accessibility, with clear navigation and professional design. Security posture is strong with HTTPS enforced and cookie consent mechanisms in place, though some security headers could be further enhanced. Overall, the website demonstrates high professionalism, trustworthiness, and compliance with privacy regulations, supporting DTCC's reputation as a trusted financial services provider.

35
75
43
55
-
80
100
financeclearingsettlementpost-tradeservicescompliance+3 more
jQuery 3.7.1Dojo 1.8.3Adobe Experience Platform (Adobe resources)Marketo Forms+5

Partner Domains:

portal.dtcc.com
service
developer.dtcc.com
service

+1 more partners

2025-06-18T08:56:04.001Z