Skip to main content

United Kingdom security reports

Browse 7,121 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157366
Websites
130
Industries
113
Countries
52
Avg Score
Page 66 of 143|Showing 3251-3300 of 7121
I

Ian Mallon Solicitors

ianmallon.com

56
OtherUnited KingdomsmallMEDIUM

Ian Mallon Solicitors is a specialist litigation law firm serving clients in Northern Ireland and the Republic of Ireland. The firm focuses on personal injury, medical negligence, oil spill claims, asbestos-related illness, and property damage claims, leveraging over 30 years of experience and dual jurisdiction qualifications. The website presents a professional and trustworthy image with clear service offerings and contact information, targeting individuals and businesses seeking expert legal counsel in these areas. Technically, the website uses modern web standards including HTML5, CSS3, JavaScript, and Google Fonts. It is well-optimized for mobile devices and provides a good user experience with clear navigation and professional design. However, there is no evidence of a CMS or advanced frameworks, and performance is moderate. The site lacks visible security headers and privacy compliance mechanisms such as cookie consent banners or privacy policies. From a security perspective, the site uses HTTPS (assumed from typical modern standards though not explicitly confirmed), but lacks security headers and incident response contact information. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data for the domain reduces trustworthiness and raises questions about domain registration legitimacy, although the website content itself appears professional and consistent. Overall, the site scores well on content quality and business credibility but has room for improvement in privacy compliance and security posture. Strategic recommendations include implementing privacy and cookie policies, adding security headers, publishing incident response contacts, and clarifying domain registration details to enhance trust and compliance.

72
55
40
70
85
35
17
legalsolicitorslitigationnorthernirelandrepublicofireland+2 more
HTML5CSS3JavaScriptGoogle Fonts
2026-06-27T07:11:53.210Z
R

Resin Bound Gravel Ltd.

resinboundgravel.org

50
Real EstateUnited KingdomsmallMEDIUM

Resin Bound Gravel Ltd. is a UK-based company specializing in the supply and installation of resin bound and resin bonded gravel paving solutions for residential, commercial, and industrial clients. The company positions itself as the UK's leading supplier and installer of resin bound gravel, offering a wide range of products and services including driveways, pathways, patios, and commercial hard landscaping. Their website reflects a professional business with a clear focus on quality and customer service, supported by certifications such as CHAS and Constructionline. Technically, the website is built on WordPress using the Divi theme, leveraging standard web technologies like jQuery and MediaElement.js. The site is hosted behind Cloudflare DNS but lacks advanced security configurations such as DNSSEC and security headers, which could be improved. The website is mobile-optimized with good navigation and content relevance but lacks privacy and cookie policies, which are important for compliance. From a security perspective, the site uses HTTPS and has domain registration protections in place, but the absence of security headers and vulnerability disclosure policies indicates room for improvement. No signs of WAF blocking or malicious content were detected, and the site is safe for general audiences. Overall, Resin Bound Gravel Ltd. presents a credible and professional online presence with moderate technical maturity and security posture. Strategic enhancements in privacy compliance and security best practices would strengthen their digital trust and compliance standing.

42
100
70
60
35
2
15
resinboundgraveldrivewayspavingconstructionresindriveways+2 more
WordPress 5.4.19Divi Theme 3.21.1jQuery 1.12.4MediaElement.js+2
2026-06-27T07:11:10.716Z
3bm.co.uk favicon

Fusion Project Management Ltd

3bm.co.uk

56
Real EstateUnited KingdommediumMEDIUM

3BM Ltd is a UK-based professional services company specializing in property-related consultancy, architecture, planning, project management, and cost consultancy. Established in 2013 and now part of the RSK Group, 3BM serves both public and private sectors with a strong focus on education, government, and real estate projects. The company leverages a skilled workforce and strategic partnerships to deliver innovative and cost-effective solutions. The website reflects a professional and consistent brand image with comprehensive service descriptions and client testimonials, positioning 3BM as a reputable player in its market segment. Technically, the website is built on WordPress with modern plugins such as WPBakery and Yoast SEO, ensuring good SEO and content management capabilities. The site uses HTTPS with a good SSL configuration and includes cookie consent mechanisms aligned with GDPR requirements. While some security headers are not explicitly detected, the overall security posture is solid with no visible vulnerabilities or exposed sensitive data. The security posture is enhanced by the use of reputable plugins and the presence of ISO certifications and professional memberships, which also serve as trust indicators. The site includes clear contact information and social media links, supporting transparency and user engagement. No signs of malicious activity or content safety concerns were found, and the site is fully accessible without WAF or blocking mechanisms. Overall, 3BM's digital presence is professional, secure, and compliant, supporting its business credibility and market positioning. Strategic recommendations include enhancing security headers, maintaining regular updates, and considering publication of a dedicated security or incident response policy to further strengthen trust and compliance.

54
70
85
20
17
40
80
propertyservicesarchitectureprojectmanagementconsultancyeducationsector+2 more
WordPress 6.7.5WPBakery Page BuilderYoast SEOjQuery+2

Partner Domains:

3bmstudio.co.uk
subsidiary
fusion-pm.co.uk
subsidiary

+1 more partners

2026-06-27T07:09:40.332Z
C

Carlsons Solicitors

carlsonssolicitors.com

66
Real EstateUnited KingdomsmallMEDIUM

Carlsons Solicitors is a full-service law firm based in London, serving both national and international clients. The firm is recognized in The Legal 500 UK 2026, indicating a strong market position and reputable service offering. Their key services include family law, residential conveyancing, probate, debt recovery, immigration, and dispute resolution. The website targets individuals and businesses seeking professional legal assistance, emphasizing client relationships and personalized service. Technically, the website is built on the Squarespace platform, leveraging modern web technologies such as Google Analytics, Google Tag Manager, and the Plyr video player. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, typical for a CMS-based site with multimedia content. From a security perspective, the site enforces HTTPS and implements a cookie consent banner, but lacks advanced security headers such as HSTS and Content-Security-Policy. No explicit security or incident response policies are published, which could be improved to enhance trust and compliance. The WHOIS data is unavailable, which reduces transparency and trustworthiness, though the professional content and client testimonials mitigate some concerns. Overall, the website presents a professional and trustworthy image suitable for a law firm, but could benefit from enhanced security practices and clearer privacy documentation to improve compliance and user trust.

80
54
100
75
17
35
95
lawfirmlegalservicesfamilylawconveyancingdisputeresolution+2 more
Squarespace CMSGoogle AnalyticsGoogle Tag ManagerjQuery+2
2026-06-27T07:09:03.204Z
A

AHR International Ltd

ahrinternational.com

41
ManufacturingUnited KingdomsmallHIGH

AHR International Ltd is a UK-based company specializing in the export and distribution of ball bearings, roller bearings, slewing rings, linear bearings, plain bearings, and couplings primarily for industrial and aerospace applications. The company positions itself as a leading European exporter with a broad product range sourced from major commercial and aerospace bearing manufacturers. Their services include technical support, bearing repair, and refurbishment, with a focus on prompt delivery from multiple stock locations worldwide. The website content is primarily informational and targeted at overseas industrial and aerospace customers. Technically, the website employs basic legacy HTML and JavaScript technologies, including Google Analytics and Ahrefs Analytics for tracking. The site lacks modern CMS or frameworks and shows limited mobile optimization and accessibility features. There is no evidence of HTTPS enforcement or advanced security headers, which indicates room for improvement in security posture. Privacy compliance mechanisms such as cookie consent banners are absent, and GDPR compliance is not clearly demonstrated. From a security perspective, the site does not exhibit WAF or security challenge mechanisms, and no critical vulnerabilities are evident in the provided content. However, the absence of HTTPS and security headers reduces the overall security score. The WHOIS data is missing or unavailable, raising concerns about domain legitimacy, though the website content and contact details appear professional and consistent with a legitimate business. Overall, the website presents a moderate risk profile with good business credibility but technical and security shortcomings. Strategic recommendations include implementing HTTPS, adding security headers, improving privacy compliance, and verifying domain registration details to enhance trust and security posture.

47
70
-
70
15
53
17
ballbearingsrollerbearingsslewingringslinearbearingsplainbearings+4 more
JavaScriptGoogle Analytics (UA-5836910-1)Ahrefs Analytics
2026-06-27T07:08:52.488Z
yoma.co.uk favicon

Yoma Digital Ltd

yoma.co.uk

70
E-commerceUnited KingdommediumMEDIUM

Yoma Digital Ltd is a UK-based full-service digital agency specializing in ecommerce development, digital marketing, and ERP integrations, notably as an exclusive Epicor Commerce partner in the UK and Ireland. The company offers a comprehensive suite of services including custom ecommerce stores, SEO, PPC, CRO, content marketing, and hosting solutions tailored to ecommerce businesses. Their market position is strengthened by strategic partnerships with major ecommerce platforms and ERP providers, supported by client testimonials and a professional online presence. Technically, the website is built on WordPress with modern integrations such as Google Tag Manager, Microsoft Clarity, LinkedIn Insight, and reCAPTCHA v3 for security. The site demonstrates good mobile optimization, SEO practices, and accessibility features. Hosting and domain registration are consistent with the company's UK base, though DNSSEC is not enabled. Security posture is solid with HTTPS enforced, secure forms, and cookie consent mechanisms in place. However, there is room for improvement in implementing comprehensive security headers and publishing explicit security policies. No vulnerabilities or exposed sensitive data were detected. Overall, the website presents a trustworthy, professional, and well-structured digital presence with strong business credibility and compliance with privacy regulations. Strategic recommendations include enhancing DNS security, security headers, and formalizing incident response policies to further strengthen security and trust.

47
75
100
85
83
2
80
ecommercedigitalmarketingseoppcmagento+5 more
WordPressPHPjQueryGoogle Tag Manager+4
2026-06-27T07:08:20.574Z
T

The Incredibly Useful Company Limited

incrediblyuseful.net

54
TechnologyUnited KingdomsmallMEDIUM

The Incredibly Useful Company Limited is a small UK-based web design and development consultancy specializing in Umbraco CMS solutions. The company targets SMEs and businesses worldwide, offering services including web design, development, ecommerce, systems integration, hosting, training, and consultancy. Their market position is that of an agile, expert provider with a focus on personalized client service and rapid response. Technically, the website is built on Umbraco CMS, hosted by UmbHost, and uses modern web technologies including Google Fonts and Google Analytics. The site is mobile-optimized with good navigation and SEO practices, though accessibility features are basic. Performance is moderate, and the site uses HTTPS. From a security perspective, the site lacks explicit security headers and privacy/cookie policies, which are critical for compliance and user trust. No WHOIS data was found, which raises concerns about domain registration legitimacy. However, the website content is professional and consistent with a legitimate business. Overall, the site presents a moderate risk profile with room for improvement in privacy compliance, security hardening, and domain registration transparency. Strategic recommendations include implementing privacy and cookie policies, adding security headers, and verifying domain registration details to enhance trust and compliance.

45
35
2
70
32
75
100
webdesignwebdevelopmentumbracocmsecommerceconsultancy+2 more
Google FontsUmbraco CMSJavaScriptCSS+2
2026-06-27T07:07:48.681Z
F

Foster Clinic Physiotherapy Centre

fosterclinic.co.uk

35
HealthcareUnited KingdomsmallHIGH

Foster Clinic Physiotherapy Centre is a small UK-based healthcare provider specializing in physiotherapy and various alternative medicine treatments such as massage, hypnotherapy, chiropody, homeopathy, reflexology, herbal medicine, and reiki. The clinic serves local communities in Gorleston, Great Yarmouth, Norfolk, and Lowestoft, Suffolk. The website content is minimal and primarily informational, targeting local residents seeking complementary health services. The business model is a traditional local clinic offering in-person treatments with no evident e-commerce or online booking capabilities. Technically, the website is built using outdated technology (Microsoft FrontPage 5.0) with no modern CMS or frameworks detected. The site lacks HTTPS, security headers, and modern performance or accessibility features. There are no analytics or tracking scripts, and no forms for user input, indicating a static informational site with limited digital maturity. From a security perspective, the absence of HTTPS and security headers is a significant concern. The WHOIS lookup failed due to domain naming rule violations, raising questions about domain legitimacy or alias usage. No privacy, cookie, or terms of service policies are present, indicating poor compliance with GDPR and other regulations. Contact information is clearly provided, but no incident response or security policies are disclosed. Overall, the website presents a low-risk profile in terms of content safety but suffers from poor technical and security posture. Strategic improvements in security, compliance, and modernization are recommended to enhance trust and protect user data.

37
65
-
70
15
50
2
healthcarephysiotherapyalternativemedicinelocalclinicuk
Microsoft FrontPage 5.0
2026-06-27T07:07:11.482Z
kendallkingscott.co.uk favicon

Kendall Kingscott

kendallkingscott.co.uk

54
Real EstateUnited KingdommediumMEDIUM

Kendall Kingscott is a well-established inter-disciplinary construction consultancy based in the UK, with a 60-year history of providing integrated architectural, surveying, project management, and low carbon consultancy services. The company targets clients in sectors such as education, healthcare, residential, commercial, and public sectors, emphasizing a holistic and collaborative approach branded as '1 Team'. The website reflects a mature digital presence with professional design, multimedia content, and clear navigation. Technically, the site uses modern JavaScript modules, Google Tag Manager for analytics, and Vimeo for video content, indicating a moderate to advanced digital infrastructure. Security posture is generally good with HTTPS and cookie consent mechanisms in place, but lacks explicit security headers and visible incident response policies. The domain WHOIS data is unavailable due to a naming rules violation error from Nominet UK, which is unusual and reduces domain trustworthiness, though the website content and business information appear legitimate and professional. Overall, the site scores well on content quality, technical implementation, and privacy compliance, but domain registration opacity and missing security policies slightly reduce the trust score.

40
70
27
90
55
2
68
constructionconsultancyarchitectureprojectmanagementbuildingsurveying+2 more
JavaScript ES modulesGoogle Tag ManagerVimeo video embeddingFlickity carousel+2

Partner Domains:

ournameismud.co.uk
partner
2026-06-27T07:07:00.876Z
ulyettlandscapes.com favicon

Ulyett Landscapes Ltd

ulyettlandscapes.com

55
Real EstateUnited KingdommediumMEDIUM

Ulyett Landscapes Ltd is a well-established landscaping and grounds maintenance company based in the United Kingdom, founded in 1967. The company serves both commercial and domestic clients, maintaining over 300 sites and offering a wide range of services including tree surgery, artificial grass installation, hard and soft landscaping, fencing, and seasonal services such as gritting and snow clearance. Their market position is strong within the East Midlands region, supported by multiple industry certifications and a solid reputation evidenced by positive customer reviews. The website reflects a professional business model focused on service delivery and client satisfaction. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, Contact Form 7, and Complianz GDPR Cookie Consent, indicating a mature digital infrastructure. The site is mobile-optimized, SEO-friendly, and integrates Google Tag Manager and Facebook Pixel for marketing and analytics purposes. Security measures include HTTPS enforcement and CAPTCHA protection on forms, although some security headers are not explicitly detected and DNSSEC is not enabled, representing areas for improvement. From a security perspective, the website demonstrates good practices with no visible vulnerabilities or exposed sensitive data. Privacy compliance is robust with clear cookie consent mechanisms and a comprehensive privacy policy. However, there is no explicit incident response or vulnerability disclosure information available, which could be enhanced to improve security posture. Overall, the domain registration data aligns well with the business claims, supporting the legitimacy and trustworthiness of the site. The overall risk assessment is low, with the website presenting a professional, secure, and compliant digital presence. Strategic recommendations include implementing additional security headers, enabling DNSSEC, and adding incident response contact details to further strengthen…

100
85
50
-
15
10
95
landscapinggroundsmaintenancetreesurgeryartificialgrasscommerciallandscaping+3 more
WordPressYoast SEOContact Form 7Complianz GDPR Cookie Consent+5
2026-06-27T07:06:39.639Z
romo.com favicon

Romo

romo.com

68
RetailUnited KingdomlargeMEDIUM

Romo is a well-established British company specializing in designer fabrics, upholstery, wallcoverings, and related accessories. Founded in 1902, it operates as part of The Romo Group, which includes several subsidiary brands. The company targets interior designers, retailers, and consumers seeking high-end interior textiles, maintaining a strong international presence with showrooms and distributors worldwide. The website reflects a professional and comprehensive digital presence, showcasing product collections, company information, and multiple contact channels. Technically, the website uses a modern technology stack including JavaScript frameworks, Cloudflare services, and a custom CMS built on Yii PHP framework. It is optimized for mobile devices, includes accessibility features, and employs security best practices such as HTTPS, CSRF tokens, and cookie consent mechanisms. Performance is moderate with good SEO and user experience. Security posture is solid with HTTPS and security headers, but lacks publicly available security policies or incident response information. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with clear privacy and cookie policies and GDPR compliance indicators. Overall, the website is trustworthy and professional, though the absence of WHOIS registration data is a concern that slightly reduces trustworthiness. Strategic recommendations include publishing explicit security policies, incident response contacts, and vulnerability disclosure information to enhance transparency and security maturity.

49
100
87
70
73
2
80
designerfabricsupholsterywallcoveringsinteriortextilesbritishdesign+3 more
JavaScriptjQueryCloudflare StreamModernizr+1

Partner Domains:

www.blackedition.com
partner
www.kirkbydesign.com
partner

+3 more partners

2026-06-27T07:06:13.125Z
silverstonerally.co.uk favicon

Silverstone Rally School

silverstonerally.co.uk

53
TransportationUnited KingdomsmallMEDIUM

Silverstone Rally School is a well-established motorsport training and experience provider based in the United Kingdom, operating since 1998. The company specializes in rally driving experiences, including half-day and full-day courses, adrenaline and off-road challenges, private tuition, junior experiences, and rally car hire. The school is accredited by the British Association of Rally Schools (BARS), offering official rally licenses and expert instruction. Their market position is strong within the niche of rally driving enthusiasts and motorsport learners, supported by positive customer reviews and professional branding. Technically, the website is built on WordPress using the Avada theme and WooCommerce for e-commerce functionality. It integrates modern marketing and analytics tools such as Google Analytics, Facebook Pixel, and Trustindex for customer reviews. The site is mobile-optimized with good SEO practices but lacks some advanced accessibility features. Performance is moderate, with asynchronous loading of scripts and optimized images. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect forms. However, it lacks visible security headers and published security or incident response policies. Privacy compliance is weak due to the absence of explicit privacy and cookie policies or consent mechanisms. Business credibility is high, supported by clear service offerings, accreditation, and trust signals. Overall, the website presents a professional and trustworthy front for Silverstone Rally School but should improve privacy compliance and security transparency to enhance user trust and regulatory adherence.

65
37
100
55
58
25
2
rallymotorsportdrivingschoolrallydrivingsilverstone+3 more
WordPressWooCommercejQueryYoast SEO+6
2026-06-27T07:05:57.189Z
annodata.co.uk favicon

Kyocera-Annodata

annodata.co.uk

76
TechnologyUnited KingdommediumLOW

Kyocera Annodata is a UK-based managed services provider specializing in digital transformation solutions including cloud, IT infrastructure, collaboration tools, content services, and cybersecurity. The company positions itself as a leading MSP in the UK market, leveraging its parent company Kyocera's brand and expertise. Their website reflects a professional and modern digital presence with a focus on business clients seeking innovative IT solutions. The business model centers on managed services and technology enablement for enterprises and mid-sized organizations. Technically, the website is built on WordPress with Elementor, integrating advanced analytics tools such as Google Analytics and Adobe Analytics, alongside a robust cookie consent mechanism via Cookiebot. The site demonstrates good SEO practices, mobile optimization, and moderate performance. Hosting is provided by GoDaddy, and the domain registration is consistent with the company's founding date in 2022. From a security perspective, the website enforces HTTPS with DNSSEC enabled and uses cookie consent to comply with GDPR. However, explicit security policies and incident response contacts are not published, and no vulnerability disclosure or security.txt file is present. The site uses third-party scripts managed through Google Tag Manager and Adobe Launch, which should be regularly audited to mitigate risks. Overall, the website is trustworthy and professional with a good security posture but could improve transparency around security policies and incident response. The domain registration data supports legitimacy, and no suspicious activity or content safety concerns were detected.

67
70
85
100
95
47
65
digitaltransformationcloudsolutionsitservicesmanagedserviceskyocera+3 more
WordPress 7.0Elementor 4.1.3Google Analytics (MonsterInsights)Cookiebot+2

Partner Domains:

kyoceraservice.co.uk
partner
shop.annodata.co.uk
partner

+1 more partners

2026-06-27T07:05:46.584Z
xcomm.co.uk favicon

X.Communications Ltd

xcomm.co.uk

62
TechnologyUnited KingdommediumMEDIUM

X.Communications Ltd (Xcomm) is a well-established UK-based provider of enterprise communication solutions, including network services, security, unified communications, and hosted telephony. The company targets a broad range of clients from small businesses to FTSE 100 companies and public sector organizations. Their market position is strengthened by partnerships with leading technology vendors such as Cisco and Cisco Meraki, and a portfolio of managed services and consultancy offerings. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress using modern plugins and libraries, delivering moderate performance and good mobile optimization. SEO practices are well implemented with proper meta tags and structured data. However, accessibility features are basic and could be improved. Security posture is solid with HTTPS enforced and no visible sensitive data exposure, but lacks some security headers and explicit incident response contacts. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. Overall, the website and domain demonstrate high legitimacy and trustworthiness, supported by consistent WHOIS data and a long domain age. The absence of blocking mechanisms or WAF challenges allows full content analysis. Strategic improvements in privacy compliance, security headers, and incident response transparency would enhance the security posture and user trust.

67
70
100
65
35
55
25
enterprisesolutionsnetworkservicessecurityservicesunifiedcommunicationshostedtelephony+4 more
WordPressPHPjQueryLayerSlider+3

Partner Domains:

linebroker.co.uk
subsidiary
2026-06-27T07:05:41.275Z
nidd-transport.com favicon

Nidd Transport Limited

nidd-transport.com

51
TransportationUnited KingdommediumMEDIUM

Delamode Nidd is a UK-based transport and logistics company specializing in UK and European distribution, warehousing, and freight forwarding services. Operating from Ripon, North Yorkshire, the company leverages over 35 years of experience and is a shareholder member of the Palletforce network, enhancing its market reach and operational efficiency. The website reflects a professional business presence targeting B2B customers requiring reliable and express delivery services across Europe. Technically, the site is built on WordPress with modern JavaScript libraries and integrates Google Analytics and ShareThis for tracking and social sharing. The site is mobile-optimized and well-structured, though some accessibility features could be improved. Security posture is adequate with HTTPS enabled but lacks visible security headers and incident response information. The absence of WHOIS data for the domain raises concerns about domain registration transparency, though the business information on the site appears legitimate. Overall, the site scores well on content quality and business credibility but should improve privacy compliance and security best practices.

20
60
53
17
75
70
37
transportlogisticswarehousingfreightforwardingukdistribution+3 more
WordPress 6.8.2jQuery 2.0.3 and 3.7.1Google AnalyticsGoogle Tag Manager+3

Partner Domains:

xpediator.com
parent
palletforce.com
partner

+1 more partners

2026-06-27T07:05:20.032Z
wakefieldacoustics.co.uk favicon

Wakefield Acoustics

wakefieldacoustics.co.uk

66
EnergyUnited KingdommediumMEDIUM

Wakefield Acoustics is a UK-based company specializing in industrial noise control solutions, including acoustic enclosures, containers, louvres, and consultancy services. Established in 1999, the company serves industrial clients primarily in the energy and manufacturing sectors, offering design, manufacturing, and installation services to ensure compliant and sustainable operations. The website reflects a professional and consistent brand image, with clear navigation and relevant content tailored to its target audience. Technically, the site is built on WordPress with modern optimization tools like NitroPack and uses standard web technologies such as jQuery and Font Awesome. Performance and mobile optimization are good, contributing to a positive user experience. Security posture is solid with HTTPS enforced and no visible vulnerabilities, though the absence of explicit security headers and security policies suggests room for improvement. Privacy compliance is limited due to missing privacy and cookie policies, which should be addressed to meet GDPR requirements. Overall, the domain registration data supports the legitimacy of the business, and the partnership with CECO Environmental adds trust. Strategic recommendations include enhancing privacy compliance, publishing security policies, and implementing security headers to strengthen the security posture.

52
100
70
70
17
53
80
industrialnoisecontrolacousticenclosuresnoisecontrolservicesukmanufacturing+1 more
WordPressNitroPack optimizationjQuerySlick Carousel+2

Partner Domains:

cecoenviro.com
partner
2026-06-27T07:04:58.647Z
bayford.co.uk favicon

Bayford Group

bayford.co.uk

47
EnergyUnited KingdommediumHIGH

The Bayford Group is a well-established UK-based diversified business with over 100 years of history, operating primarily in energy, property, hospitality, and investments. Their website reflects a professional and consistent brand presence, showcasing their key services and business sectors clearly. The company targets business clients and investors interested in these sectors, leveraging a diversified business model with a strong heritage in energy and expanding into green technologies and property investments. Technically, the website is built on WordPress with modern frameworks like Bootstrap and uses common plugins such as Contact Form 7 and WPBakery Page Builder. The site is mobile-optimized and includes Google Analytics and reCAPTCHA for security and analytics. However, some technical improvements could be made, such as adding security headers and cookie consent mechanisms to enhance compliance and security posture. From a security perspective, the site uses HTTPS and implements Google reCAPTCHA on its contact form, which are positive indicators. However, the absence of explicit security headers and incident response information suggests room for improvement in security maturity. No vulnerabilities or suspicious content were detected, and the domain's long history supports legitimacy. Overall, the Bayford Group website presents a credible and professional business presence with moderate technical sophistication and a good security baseline. Strategic enhancements in privacy compliance and security policies would further strengthen their digital trust and regulatory adherence.

80
57
-
70
53
17
15
energypropertyhospitalityinvestmentsbusiness+1 more
WordPress 7.0BootstrapjQueryGoogle reCAPTCHA+5

Partner Domains:

linkedin.com
partner
2026-06-27T07:04:42.714Z
hrponline.co.uk favicon

Beijer Ref UK

hrponline.co.uk

60
EnergyUnited KingdomlargeMEDIUM

Beijer Ref UK is a leading wholesale supplier of premium refrigeration and air conditioning equipment in the United Kingdom. The company positions itself as the UK’s foremost wholesaler in this sector, targeting trade professionals and businesses requiring HVAC solutions. Their business model focuses on providing top brands, expert support, and fast delivery services, catering primarily to the trade market. Founded in 2015, the company has established a strong market presence with a large operational scale. Technically, the website is built on modern frameworks such as Nuxt.js and Vue.js, indicating a contemporary and maintainable digital infrastructure. The site demonstrates good mobile optimization and SEO practices, although some accessibility features could be enhanced. Hosting and domain registration details align with a reputable UK-based business, and the site uses HTTPS with a good SSL configuration. From a security perspective, the website enforces HTTPS and uses deferred loading for third-party scripts like OneSignal. However, it lacks some recommended security headers such as Content-Security-Policy and X-Frame-Options, which could improve protection against certain web attacks. Privacy compliance is partially addressed with a comprehensive privacy policy, but the absence of a cookie consent mechanism is a notable gap. No explicit security policy or incident response contact information is provided. Overall, the website presents a professional and trustworthy front with a solid business foundation. Strategic improvements in security headers and privacy consent mechanisms would enhance compliance and user trust. The domain registration data supports the legitimacy of the business, with no suspicious patterns detected.

80
100
37
70
15
22
73
refrigerationairconditioningwholesaleukhvac+1 more
Nuxt.jsVue.jsOneSignal (push notifications)Iconify icons
2026-06-27T07:04:21.402Z
brettstransport.co.uk favicon

Bretts Transport Ltd

brettstransport.co.uk

47
TransportationUnited KingdommediumHIGH

Bretts Transport Ltd is a well-established family-run logistics and transportation company based in the United Kingdom, specializing in haulage, distribution, warehousing, and storage services. With a history dating back to 1933, the company positions itself as a primary supply chain specialist serving businesses requiring comprehensive transport and storage solutions. The website reflects a professional and consistent brand image, highlighting key accreditations and a strong local presence. Technically, the website employs a modern technology stack including jQuery, Bootstrap, and Google Analytics, hosted on a CMS platform likely Umbraco. The site is mobile-optimized with good SEO practices and accessible navigation. Security measures include HTTPS enforcement and use of Google reCAPTCHA, although some security headers and explicit policies are missing. The security posture is solid but could be improved by adding formal security policies, incident response contacts, and vulnerability disclosure mechanisms. Privacy compliance is basic with a cookie consent banner and privacy policy present, but GDPR compliance indicators are limited. Contact information is clearly provided, enhancing business credibility. Overall, the website is trustworthy and professionally maintained, but the lack of WHOIS data due to domain registration query issues introduces some uncertainty. Strategic recommendations include verifying domain registration details, enhancing security policies, and improving privacy compliance documentation.

60
47
20
70
83
2
15
transportationhaulagedistributionwarehousinglogistics+4 more
jQueryBootstrap 3.3.7ModernizrGoogle Analytics+2

Partner Domains:

bretts.roadrunnerlive.co.uk
partner
2026-06-27T07:04:16.091Z
B

Balfour Lewis

balfourlewis.com

38
OtherUnited KingdomsmallHIGH

Balfour Lewis is a UK-based legal resourcing and consulting firm specializing in recruitment services tailored for the legal profession. The company positions itself as a trusted advisor to law firms, focusing on strategic recruitment projects rather than commoditized candidate placement. The website reflects a small-sized business with a clear target audience of legal professionals and law firms. The domain age and business founding year align, supporting legitimacy. Technically, the website runs on an outdated WordPress 3.6.1 CMS with legacy jQuery 1.9.1, which introduces security risks. The site uses Google Analytics and Google Tag Manager for tracking but lacks visible cookie consent mechanisms. The design is professional with clear navigation, but mobile optimization and accessibility are basic. No forms or email contacts are present, limiting direct user engagement. From a security perspective, HTTPS is enabled but no security headers are detected, and DNSSEC is not enabled for the domain. The outdated software versions increase vulnerability exposure. No privacy, cookie, or terms of service policies were found, indicating compliance gaps with GDPR and other regulations. Contact information is limited to a phone number, with no email or physical address disclosed. Overall, the website is functional and professional but requires significant improvements in security posture, privacy compliance, and technical modernization to reduce risk and enhance trustworthiness.

52
60
70
-
35
2
15
legalresourcingconsultingrecruitmentlawyer
jQuery 1.9.1Google AnalyticsEasy FancyBox plugin
2026-06-27T07:03:06.835Z