
N
Norton Peskett Solicitors
nortonpeskett.co.uk
OtherUnited KingdommediumHIGH Norton Peskett Solicitors is a well-established law firm based in East Anglia, UK, with a history dating back to the 1830s. The firm offers a comprehensive range of legal services to both individuals and businesses, including criminal defence, family law, employment law, residential and commercial property, injury claims, mediation, and wills and probate. With multiple branch offices and over 120 experienced employees, Norton Peskett holds a strong regional market position supported by numerous accreditations and client testimonials. The website reflects a professional and trustworthy business with clear contact information and a user-friendly design.
Technically, the website is built on WordPress 7.0 with modern SEO and analytics tools such as Yoast SEO, Google Analytics, Google Tag Manager, and Hotjar. It employs HTTPS with good SSL configuration and uses Google reCAPTCHA to secure forms. Cookie consent mechanisms and a privacy policy indicate GDPR compliance. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contact is published.
From a security perspective, the site demonstrates good practices including HTTPS enforcement, anti-phishing warnings, and form protection. The absence of WHOIS data is unusual but likely due to querying the subdomain 'www' rather than the root domain. Despite this, the business legitimacy is supported by consistent branding, accreditations, and detailed contact information. Overall, the site scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility.
Recommendations include implementing comprehensive security headers, publishing a security policy and incident response contacts, and adding a security.txt file to facilitate vulnerability disclosures. These steps would enhance the security posture and trustworthiness further.
lawfirmsolicitorslegalserviceseastangliafamilylaw+5 more WordPress 7.0Yoast SEO pluginGoogle AnalyticsGoogle Tag Manager+3
Partner Domains:
www.eastmediation.co.ukpartner