Skip to main content

United Kingdom security reports

Browse 6,690 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

156127
Websites
130
Industries
113
Countries
52
Avg Score
Page 45 of 134|Showing 2201-2250 of 6690
swallowsnursery.co.uk favicon

Swallows Nursery & Plant Centre Ltd

swallowsnursery.co.uk

49
RetailUnited KingdomsmallHIGH

Swallows Nursery & Plant Centre Ltd operates an independent retail plant nursery located in Mixbury, North Oxfordshire, UK. The company specializes in growing and selling high-quality plants, including shrubs, bedding plants, trees, and topiary, with an emphasis on peat-free products. Additionally, the business offers an onsite cafe serving coffee, Nordic cakes, brunch, and lunch on select days, enhancing the customer experience. The nursery also caters to trade buyers and provides delivery services. The website reflects a small, locally focused business with a strong community presence and a commitment to quality and sustainability. Technically, the website is built on WordPress using WooCommerce for e-commerce capabilities, WPBakery Page Builder for layout, and integrates several modern libraries such as Bootstrap 5 and jQuery. The site is mobile-optimized and includes SEO best practices like meta tags and structured data. However, some technical improvements are recommended, including the implementation of security headers and a cookie consent mechanism to enhance privacy compliance. From a security perspective, the site enforces HTTPS and uses secure forms with anti-spam measures. No critical vulnerabilities or exposed sensitive data were detected. The absence of security headers and incomplete analytics setup slightly reduce the security posture. The WHOIS data for the domain is unavailable or invalid, which raises concerns about domain registration legitimacy, though the presence of a UK company registration number and consistent business information on the site supports its legitimacy. Overall, the website presents a professional and trustworthy front for a small retail nursery business. Strategic recommendations include improving privacy compliance with cookie consent, adding security headers, clarifying WHOIS/domain registration status, and enhancing analytics implementation to support business growth and security assurance.

27
100
70
65
2
15
35
plantnurserygardeningretailcafeuk+2 more
WordPressWooCommerceWPBakery Page BuilderBootstrap 5+4
2026-07-02T07:24:04.611Z
rjca.co.uk favicon

Richardson Jones Chartered Accountants

rjca.co.uk

50
FinanceUnited KingdomsmallMEDIUM

Richardson Jones Chartered Accountants is a well-established independent accounting firm based in Marlow, UK, with a history dating back to 1987. The company offers a comprehensive range of financial services including taxation, auditing, business consultancy, payroll, and HR services, catering to a diverse client base from multinational corporations to individual taxpayers. The firm holds ICAEW accreditation, reinforcing its professional credibility and commitment to quality service. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics integrated. The site demonstrates good mobile optimization, accessibility, and performance, hosted by GoDaddy. The presence of cookie consent mechanisms and GDPR-compliant privacy policies indicates a mature approach to privacy and regulatory compliance. From a security perspective, the site uses HTTPS and employs WordFence security plugin implied by cookies, but lacks explicit security headers and published security policies or incident response contacts. No vulnerabilities or suspicious activities were detected in the content or scripts. Overall, the security posture is solid but could be improved with additional headers and transparency. The website is professional, trustworthy, and safe for general audiences, with no adult or questionable content. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic recommendations include enhancing security headers, publishing security policies, and maintaining regular audits of third-party components.

47
75
65
20
25
80
2
accountingcharteredaccountantstaxservicesbusinessconsultancyfinance+2 more
WordPressYoast SEO pluginjQueryGoogle Analytics+2
2026-07-02T07:23:42.300Z
T

The Marsh Agency

marsh-agency.co.uk

47
MediaUnited KingdomsmallHIGH

The Marsh Agency is a UK-based literary agency established in 1997, offering international representation services to writers, literary agents, and publishing companies. The website reflects a professional and consistent brand presence targeting literary professionals and publishing industry stakeholders. The business model centers on representation and rights management, positioning the agency as an established player in the media sector with a small company size. Technically, the website is built on WordPress with Bootstrap and jQuery frameworks, hosted by Zen Internet Limited. It employs Google Analytics and Tag Manager for user tracking and marketing insights. The site is moderately performant with good mobile optimization and basic accessibility features. SEO practices appear adequate with proper meta tags and structured navigation. From a security perspective, the site uses HTTPS with good SSL configuration but lacks explicit security headers such as CSP or HSTS. Forms include basic anti-spam measures but no visible cookie consent or privacy compliance mechanisms beyond a privacy policy page. No incident response or security policy information is published, indicating room for improvement in security transparency and GDPR compliance. Overall, the website is trustworthy and professionally maintained, with a solid business credibility score. However, enhancements in privacy compliance, security headers, and incident response disclosures would strengthen the security posture and regulatory adherence.

70
20
80
57
53
15
2
literaryagencypublishingwritersrepresentationinternationalrepresentationmedia
jQueryBootstrapGoogle AnalyticsGoogle Tag Manager+2
2026-07-02T07:21:38.943Z
kdmevents.co.uk favicon

KDM Events Ltd

kdmevents.co.uk

59
OtherUnited KingdommediumMEDIUM

KDM Events Ltd is a UK-based corporate events management company specializing in team building, conferences, and corporate event services. The company positions itself as an award-winning provider delivering services across the UK, targeting corporate clients seeking professional event planning and management. Their key offerings include team building activities, conference management, audio visual services, content and design, audience engagement, and awards ceremonies. The website reflects a medium-sized business with a professional and consistent brand presence. Technically, the website is built on WordPress and leverages a modern technology stack including jQuery, Google Analytics, Google Tag Manager, Google reCAPTCHA, New Relic monitoring, and CookieYes for consent management. The site is mobile optimized and demonstrates good SEO practices with structured data and meta tags. Performance is moderate with room for improvement in accessibility. From a security perspective, the site enforces HTTPS, uses reCAPTCHA to mitigate spam, and implements cookie consent mechanisms. However, it lacks visible security headers and does not publish a privacy policy or terms of service within the analyzed content. The WHOIS data is unavailable or invalid, raising concerns about domain registration legitimacy, although the website content itself appears professional and trustworthy. Overall, the website presents a solid business and technical foundation but should address privacy policy publication, improve security headers, and clarify domain registration details to enhance trust and compliance.

37
100
70
60
20
17
95
corporateeventsteambuildingconferencemanagementukbusinesseventplanning
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+9
2026-07-02T07:21:22.771Z
vesselgallery.com favicon

Vessel Gallery

vesselgallery.com

58
OtherUnited KingdomsmallMEDIUM

Vessel Gallery is a London-based contemporary art gallery specializing in high-end art glass, ceramics, sculpture, and decorative lighting. The gallery positions itself as a UK leader in museum-quality contemporary art glass and serves collectors, interior designers, and art enthusiasts. Their business model revolves around exhibitions, sales, and commissions, supported by a professional online presence and active social media engagement. The website is powered by the MasterArt platform, indicating a specialized infrastructure for art galleries. Technically, the website employs modern web technologies including jQuery, Bootstrap 4.3.1, and Slick Carousel for UI components, alongside Google Analytics and Mailchimp for marketing and analytics. The site is mobile-optimized with good SEO practices and a cookie consent mechanism, reflecting a moderate to good digital maturity level. However, some security headers and explicit security policies are not evident, suggesting room for improvement in security hardening. From a security perspective, the site uses HTTPS and has implemented cookie consent, but lacks visible security headers and incident response information. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data for the domain is a concern and reduces trustworthiness, although the website content and business information appear legitimate and professional. Overall, the website scores well in content quality and privacy compliance but could improve in security posture and domain registration transparency. Strategic recommendations include enhancing security headers, verifying domain registration details, and adding incident response contacts to strengthen trust and compliance.

70
57
100
75
2
68
15
artglasscontemporaryartgallerysculptureceramics+4 more
jQueryBootstrap 4.3.1Slick CarouselGoogle Analytics+1
2026-07-02T07:20:42.683Z
nortonpeskett.co.uk favicon

Norton Peskett Solicitors

nortonpeskett.co.uk

48
OtherUnited KingdommediumHIGH

Norton Peskett Solicitors is a well-established law firm based in East Anglia, UK, with a history dating back to the 1830s. The firm offers a comprehensive range of legal services to both individuals and businesses, including criminal defence, family law, employment law, residential and commercial property, injury claims, mediation, and wills and probate. With multiple branch offices and over 120 experienced employees, Norton Peskett holds a strong regional market position supported by numerous accreditations and client testimonials. The website reflects a professional and trustworthy business with clear contact information and a user-friendly design. Technically, the website is built on WordPress 7.0 with modern SEO and analytics tools such as Yoast SEO, Google Analytics, Google Tag Manager, and Hotjar. It employs HTTPS with good SSL configuration and uses Google reCAPTCHA to secure forms. Cookie consent mechanisms and a privacy policy indicate GDPR compliance. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contact is published. From a security perspective, the site demonstrates good practices including HTTPS enforcement, anti-phishing warnings, and form protection. The absence of WHOIS data is unusual but likely due to querying the subdomain 'www' rather than the root domain. Despite this, the business legitimacy is supported by consistent branding, accreditations, and detailed contact information. Overall, the site scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility. Recommendations include implementing comprehensive security headers, publishing a security policy and incident response contacts, and adding a security.txt file to facilitate vulnerability disclosures. These steps would enhance the security posture and trustworthiness further.

65
20
60
47
53
15
17
lawfirmsolicitorslegalserviceseastangliafamilylaw+5 more
WordPress 7.0Yoast SEO pluginGoogle AnalyticsGoogle Tag Manager+3

Partner Domains:

www.eastmediation.co.uk
partner
unity.online
partner
2026-07-02T07:19:51.531Z
connect2t.co.uk favicon

Connect 2 Technology

connect2t.co.uk

67
ManufacturingUnited KingdommediumMEDIUM

Connect 2 Technology is a well-established UK-based contract electronics manufacturer specializing in cable assemblies, wiring harnesses, electronic box build, and related interconnection solutions. With over 30 years of experience and part of the Cleveland Technologies Group, the company serves OEMs and engineering teams requiring reliable, custom manufacturing support from prototype to volume production. Their market position is strengthened by certifications such as ISO 9001:2015 and IPC A-620, and a clear focus on quality and UK manufacturing standards. Technically, the website is built on the HubSpot CMS platform, leveraging modern web technologies including Google Tag Manager and Mux video streaming. The site demonstrates good performance, mobile optimization, and accessibility, with comprehensive SEO and metadata implementation. Privacy compliance is well addressed with a cookie consent banner and Google Consent Mode integration. From a security perspective, the site enforces HTTPS and employs standard best practices, though explicit security headers could be enhanced. No vulnerabilities or exposed sensitive data were detected. The WHOIS data confirms a long-standing domain registration consistent with the business history, enhancing trustworthiness. Overall, the website presents a professional, trustworthy, and compliant digital presence for a medium-sized manufacturing business. Strategic recommendations include improving security header implementation, publishing a formal security policy and incident response contacts, and considering a vulnerability disclosure policy to further enhance security posture and customer trust.

80
70
100
39
95
45
17
manufacturingcableassemblieselectronicsukcontractmanufacturing+2 more
HubSpot CMSGoogle Tag ManagerSlick CarouselMux Video Streaming+1

Partner Domains:

ctecgroup.co.uk
parent
pcb.co.uk
sister
2026-07-02T07:19:46.147Z
A

AVS Fencing & Landscaping Supplies Ltd

avsfencing.co.uk

70
RetailUnited KingdommediumMEDIUM

AVS Fencing & Landscaping Supplies Ltd is a well-established UK-based supplier specializing in fencing, landscaping, and outdoor living materials. With over 25 years of experience, the company serves both DIY enthusiasts and trade customers primarily in the South East of England. The website reflects a professional retail and trade supplier business model with a clear focus on quality products and customer service. The company maintains an active online presence with integrated social media channels and customer review platforms such as Trustpilot. Technically, the website is built on the Magento 2 e-commerce platform, leveraging modern JavaScript libraries such as RequireJS and jQuery. It incorporates multiple third-party analytics and marketing tools including Google Analytics, Facebook Pixel, Bing Ads, and New Relic for performance monitoring. The site is mobile-optimized and demonstrates good SEO practices with proper meta tags and structured data. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect forms. However, some standard security headers like Content-Security-Policy and X-Frame-Options are not explicitly detected, suggesting an opportunity for improvement. No critical vulnerabilities or exposed sensitive data were found. Privacy and cookie policies are present and include consent mechanisms, indicating basic GDPR compliance. Overall, the website presents a trustworthy and professional front for AVS Fencing & Landscaping. The lack of WHOIS data due to domain registration issues is a concern but does not detract from the legitimacy of the business as evidenced by the detailed contact information and business presence. Strategic recommendations include enhancing security headers, improving incident response visibility, and continuing to monitor third-party scripts for vulnerabilities.

65
69
100
75
70
88
17
e-commercefencinglandscapingretailmagento+1 more
Magento 2RequireJSjQueryGoogle Tag Manager+5
2026-07-02T07:19:35.383Z
oceanbluesoftware.com favicon

Ocean Blue Software Ltd.

oceanbluesoftware.com

67
TechnologyUnited KingdommediumMEDIUM

Ocean Blue Software Ltd. is a UK-based company specializing in Smart TV and broadcast software services, including middleware development, testing, certification, and platform integration. Established in 2005, it serves a global clientele including TV operators, manufacturers, and silicon partners. The company positions itself as a trusted partner with over 20 years of industry experience and a strong presence in the broadcast and Smart TV ecosystem. Their website reflects a professional and modern digital presence built on Next.js and React frameworks, optimized for performance and mobile responsiveness. Privacy and cookie policies are implemented with consent mechanisms, indicating compliance with GDPR standards. However, direct contact information such as emails or phone numbers is not prominently displayed on the homepage, which may affect immediate customer engagement. Security posture is generally good with HTTPS enforced and cookie consent in place, but the absence of explicit security headers and incident response contacts suggests room for improvement. The WHOIS lookup for the domain failed due to a domain naming error, raising concerns about domain registration legitimacy, though the website content and branding strongly indicate a legitimate business. Overall, the site scores well on content quality, technical implementation, and privacy compliance, with recommendations to enhance security headers and provide clearer contact channels.

65
55
77
100
70
2
83
smarttvbroadcastmiddlewaresoftwaredevelopmenttesting+3 more
ReactNext.jsJavaScriptCSS+1
2026-07-02T07:19:08.029Z
V

Viking Tapes

vikingtapes.co.uk

71
E-commerceUnited KingdomsmallMEDIUM

Viking Tapes operates as a UK-based e-commerce retailer specializing in adhesive tapes and related products, prominently featuring 3M branded tapes, masking tapes, eco-friendly tapes, and glue dots. The website positions itself as a market leader in the UK online tape market, targeting both business and consumer customers. The business model is focused on direct online sales through a Shopify-powered platform, leveraging over 25 years of industry experience to provide expert advice and product offerings. Technically, the website is built on Shopify, utilizing modern analytics and marketing tools such as Google Analytics, Microsoft Clarity, Sendinblue, and Brevo, indicating a mature digital infrastructure. The site is mobile-optimized with good SEO and basic accessibility features, though there is room for improvement in accessibility compliance and security header implementation. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, but lacks explicit security policies and vulnerability disclosure information. WHOIS data for the queried domain 'www.vikingtapes.co.uk' is unavailable due to invalid query format; however, the website content and technical setup suggest a legitimate business. Overall, the site is professional, trustworthy, and safe for general audiences, with moderate risk due to incomplete WHOIS transparency and missing privacy policy documentation.

100
85
44
70
75
17
100
e-commerceadhesivetapes3mtapesmaskingtapesshopify+4 more
ShopifyGoogle AnalyticsGoogle Tag ManagerSendinblue+4
2026-07-02T07:18:57.311Z
ecipartners.com favicon

ECI Partners

ecipartners.com

61
FinanceUnited KingdommediumMEDIUM

ECI Partners is a growth-focused private equity firm specializing in supporting European businesses valued between £50 million and £350 million. The company positions itself as a strategic partner for growth, providing investment and support to mid-market businesses. The website reflects a professional and consistent brand image, targeting corporate clients in the finance sector primarily within the UK and Europe. The business model centers on private equity investment and partnership, aiming to foster growth in its portfolio companies. Technically, the website is built on WordPress and leverages a modern technology stack including jQuery, Google Tag Manager, Cookiebot for consent management, HubSpot and Pardot for marketing automation, and Hotjar for user behavior analytics. The site is hosted likely on WP Engine, indicating a managed hosting environment optimized for WordPress. The website demonstrates good SEO, accessibility, and mobile optimization, providing a positive user experience. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms, indicating awareness of privacy regulations. However, there is no explicit privacy policy or terms of service detected in the provided content, nor is there a security.txt or vulnerability disclosure page. WHOIS data is unavailable, which reduces trustworthiness from a domain registration perspective. No contact emails or phone numbers are explicitly provided, limiting direct communication channels. Overall, the website is professional and well-constructed but would benefit from enhanced transparency regarding privacy, security policies, and incident response contacts. The absence of WHOIS data is a concern but may be due to privacy protection or registry issues. Strategic recommendations include publishing clear privacy and terms policies, adding security contact information, and maintaining regular security audits of third-party scripts and integrations.

57
80
65
100
10
83
15
privateequityfinanceinvestmentgrowthbusiness+3 more
jQueryGoogle Tag ManagerCookiebotHubSpot+3
2026-07-02T07:18:40.251Z
kingstonrecruitment.co.uk favicon

Kingston Recruitment Ltd

kingstonrecruitment.co.uk

46
OtherUnited KingdomsmallHIGH

Kingston Recruitment Ltd is a well-established recruitment agency based in Hull, East Yorkshire, specializing in office and commercial recruitment services including temporary, contract, and permanent placements. Founded in 1985, the company serves both candidates and clients with a strong regional presence and a reputation for quality service. The website reflects a professional business model focused on staffing solutions for a variety of sectors. Technically, the website employs a modern frontend stack including Bootstrap, jQuery, Owl Carousel, and integrates live chat via Tawk.to and analytics through Google Analytics and Tag Manager. The site is mobile optimized and provides a good user experience with clear navigation and relevant content. Security posture is moderate; HTTPS is implied but no security headers were detected in the provided data, and no explicit security or incident response policies are published. Privacy compliance is basic with a privacy policy present but lacking cookie consent mechanisms. WHOIS data could not be retrieved due to domain naming issues, which raises concerns about domain registration consistency but does not directly impact the legitimacy of the business as presented on the site. Overall, the website is professional and trustworthy but would benefit from enhanced security and privacy practices.

70
65
20
57
15
17
53
recruitmentjobsemploymenthulleastyorkshire+3 more
jQueryBootstrapOwl CarouselPrettyPhoto+2
2026-07-02T07:18:08.585Z
ukelectronics.co.uk favicon

UK Electronics

ukelectronics.co.uk

52
ManufacturingUnited KingdommediumMEDIUM

UK Electronics is a well-established UK-based contract electronic manufacturer specializing in high-quality electronic assemblies, PCB assembly, and box build services. With over 40 years of experience, the company serves diverse sectors including military, aviation, and medical, offering a full turnkey manufacturing solution. Their UK-based facility emphasizes quality, traceability, and responsive communication, supported by multiple industry certifications such as ISO 9001, ISO 14001, and IPC standards. The website reflects a professional and comprehensive digital presence with clear service offerings and strong trust indicators. Technically, the website is built on WordPress with modern technologies including jQuery and Google Analytics GA4 for tracking. SEO and accessibility are well addressed, though some improvements in security headers and accessibility could be made. The site uses HTTPS with a cookie consent mechanism, indicating good privacy compliance. No WAF or blocking mechanisms were detected, allowing full content access. Security posture is solid with HTTPS and no exposed sensitive data, but the absence of explicit security headers and incident response information suggests room for enhancement. The WHOIS lookup for the exact subdomain failed due to naming rules, but this is a known limitation when querying subdomains rather than the registered domain. Overall, the domain and website appear legitimate and trustworthy. Recommendations include implementing additional security headers, publishing a vulnerability disclosure policy, enhancing accessibility features, and maintaining regular audits of third-party scripts to sustain security and compliance standards.

70
20
47
85
73
17
15
electronicsmanufacturingukpcbassemblycontractmanufacturing+2 more
jQuery 3.3.1Google Analytics GA4Yoast SEO pluginSlick Slider+1

Partner Domains:

bc-design.co.uk
partner
2026-07-02T07:17:57.774Z
am-energy.com favicon

A&M Energy Solutions

am-energy.com

66
EnergyUnited KingdommediumMEDIUM

A&M Energy Solutions is a UK-based medium-sized company specializing in the supply and installation of loft and cavity wall insulation products for homeowners, contractors, local authorities, and landlords. The company positions itself as a reliable energy-saving insulation contractor with multiple depots across the UK, offering bespoke solutions to improve energy efficiency and reduce energy bills. Their website reflects a professional and consistent brand image with clear navigation and relevant content tailored to their target audiences. Technically, the website is built on WordPress using common plugins such as Gravity Forms and Yoast SEO, with integrations for Google Analytics, Google Tag Manager, Hotjar, and Trustpilot for customer reviews. The site is mobile-optimized and includes GDPR-compliant cookie consent mechanisms. However, the use of an outdated jQuery version and lack of advanced security headers indicate areas for technical improvement. From a security perspective, the site enforces HTTPS and uses a consent management platform, but lacks visible security headers and incident response contact information. The absence of WHOIS registration data raises concerns about domain legitimacy, although the website content and business information appear credible. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website scores well on content quality, privacy compliance, and business credibility but could enhance its security posture and domain transparency. Strategic recommendations include updating technical components, implementing additional security headers, and publishing vulnerability disclosure information to strengthen trust and security culture.

32
85
85
100
65
80
2
energyinsulationloftinsulationcavitywallinsulationenergysaving+5 more
jQuery 1.12.4Gravity Forms pluginYoast SEO pluginGoogle Tag Manager+6
2026-07-02T07:16:57.330Z
formwork.co.uk favicon

Special Formwork

formwork.co.uk

39
ManufacturingUnited KingdomsmallHIGH

Special Formwork is a UK-based specialist company focused on the design and manufacture of bespoke steel formwork systems for concrete casting, serving the construction and infrastructure sectors. The company positions itself as a leading UK provider with a strong emphasis on quality and innovation, targeting construction companies and civil engineers. Their product portfolio includes column formwork, tunnel and shaft formwork, sea defence solutions, and construction equipment fabrication. The website reflects a professional and consistent brand image aligned with their business focus. Technically, the website is built on WordPress using modern plugins and themes such as Yoast SEO, WPBakery Page Builder, and MonsterInsights for analytics. The site is mobile-optimized with good SEO practices and moderate performance. Security measures include HTTPS enforcement and standard security headers, although some improvements could be made in cookie consent and published security policies. The security posture is solid with no evident vulnerabilities or exposed sensitive data. However, the absence of a visible cookie consent mechanism and lack of published incident response or vulnerability disclosure policies indicate areas for compliance enhancement. The WHOIS data for the domain is unavailable due to a naming rules error, which limits domain legitimacy verification but does not detract from the professional presentation of the website. Overall, the website presents a trustworthy and professional digital presence for Special Formwork, with recommendations to improve privacy compliance and security transparency to further strengthen trust and regulatory adherence.

27
55
55
20
40
35
2
steelformworkconstructionmanufacturingukbespokedesign+2 more
WordPressPHPjQueryGoogle Analytics+4
2026-07-02T07:16:51.748Z
boningale.co.uk favicon

Boningale Ltd.

boningale.co.uk

47
OtherUnited KingdomlargeHIGH

Boningale Ltd. operates one of the UK’s largest horticultural businesses, specializing in large scale nursery production and plant supply across multiple divisions. The company targets industry professionals and large projects within the horticulture and landscape sectors. Their business model focuses on multi-site production, contract growing, and a webshop for plant sales, positioning them as a key player in the UK horticulture market. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress 7.0 with modern plugins such as Yoast SEO and Google Tag Manager integration. The site is mobile-optimized and uses asynchronous loading for analytics scripts, indicating a moderate to good digital maturity. However, some accessibility features could be improved, and hosting details remain unknown. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks important security headers and does not publish a security policy or incident response contacts. The absence of a cookie consent mechanism also indicates partial GDPR compliance. The WHOIS data is unavailable and shows an error from the registry, which raises concerns about domain registration legitimacy despite the professional website presence. Overall, the site presents a low risk to users and appears trustworthy for business purposes, but the domain registration anomaly should be investigated further. Strategic improvements in security headers, privacy compliance, and transparency would enhance trust and reduce potential risks.

57
65
40
70
2
15
53
horticulturenurseryplantsukbusinessprofessional+2 more
WordPress 7.0Yoast SEO pluginjQuery 3.7.1Google Tag Manager+2
2026-07-02T07:16:03.640Z
ethitec.com favicon

Ethical Technology Ltd t/a Ethitec

ethitec.com

69
HealthcareUnited KingdomsmallMEDIUM

Ethitec, trading as Ethical Technology Ltd, is a UK-based software company established in 1975 specializing in healthcare and public sector software solutions. Their flagship products include ELMS2, a community equipment management system, and Tiara9, a clinical management system widely used by NHS and allied health professionals. The company positions itself as a trusted provider with a strong focus on quality, evidenced by ISO 9001:2015 and Cyber Essentials Plus certifications. Their target audience includes public sector organizations, healthcare providers, and private sector clients requiring bespoke software solutions. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and uses Google Analytics and reCAPTCHA for tracking and security. The site is mobile-optimized with good navigation and content quality. However, some security best practices like security headers are missing, and WHOIS data for the domain is unavailable, which slightly reduces transparency. Security posture is solid with HTTPS enforced, privacy and cookie consent mechanisms in place, and certifications that indicate a mature security approach. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is good with GDPR-aligned policies and consent management. Business credibility is high due to clear contact information, certifications, and professional content. Overall, Ethitec presents a professional and trustworthy online presence with room for improvement in domain transparency and security headers. Strategic recommendations include publishing security headers, adding incident response contacts, and maintaining up-to-date software to enhance security and trust.

37
80
100
85
70
65
47
healthcaresoftwarenhsclinicalmanagementcommunityequipment+2 more
WordPress 5.7.15jQuery 3.5.1BootstrapGoogle Analytics+3

Partner Domains:

8foldgovernance.com
partner
2026-07-02T07:15:20.678Z
baltic.art favicon

BALTIC Centre for Contemporary Art

baltic.art

66
Non-profitUnited KingdommediumMEDIUM

Baltic Centre for Contemporary Art is a well-established non-profit cultural institution located in the United Kingdom, focused on contemporary art exhibitions, events, and community engagement. The website reflects a mature digital presence with comprehensive content, clear navigation, and strong branding consistency. It serves a broad audience including art enthusiasts, local communities, families, and visitors. The business model emphasizes free public access to art and cultural experiences, supplemented by venue hire and retail services. Technically, the website employs modern web technologies such as jQuery, Swiper.js, and Litepicker, integrated with analytics and marketing tools including Google Analytics, Facebook Pixel, and Hotjar. The site is built on a proprietary CMS (You.Create by Grandad Digital) and demonstrates good mobile optimization and accessibility features, including the ReciteMe accessibility tool. From a security perspective, the site uses HTTPS with strong SSL configuration but lacks explicit security headers and a published security policy or incident response plan. The domain WHOIS data is transparent and consistent with the organization's identity, enhancing trustworthiness. Privacy and cookie policies are present and GDPR compliant, with an active consent mechanism. Overall, Baltic.art presents a professional, secure, and user-friendly platform that aligns well with its mission as a non-profit art centre. Strategic improvements in security headers and incident response transparency could further enhance its security posture and stakeholder confidence.

70
70
47
100
65
83
2
artcontemporaryartgalleryculturenon-profit+3 more
jQuery 3.6.1LitepickerSwiper.jsGoogle Analytics (GA4 and Universal Analytics)+3

Partner Domains:

shop.balticmill.com
partner
archive.baltic.art
partner

+2 more partners

2026-07-02T07:14:15.945Z
fountaincourt.co.uk favicon

Fountain Court

fountaincourt.co.uk

69
FinanceUnited KingdommediumMEDIUM

Fountain Court Chambers is a prestigious set of commercial barristers based in London with an additional office in Singapore. They specialize in commercial disputes, litigation, and arbitration, serving clients both in the UK and internationally. The chambers are recognized as leaders in their field, with numerous accolades and a strong reputation for expertise and professionalism. Their website reflects a mature digital presence with comprehensive content, clear navigation, and strong branding consistent with their market position. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and uses industry-standard SEO and analytics tools including Yoast SEO and Google Analytics. The site is mobile-optimized, accessible, and performs moderately well, with room for improvement in security headers and performance tuning. The presence of cookie consent mechanisms and GDPR compliance indicates a good level of privacy awareness. From a security perspective, the site uses HTTPS and Cloudflare bot management, but lacks explicit security headers and a published vulnerability disclosure policy. No critical vulnerabilities or exposed sensitive data were detected. Contact information is clearly provided, but incident response contacts are not explicitly stated. Overall, Fountain Court Chambers presents a trustworthy, professional, and well-maintained online presence suitable for their legal services business. Strategic recommendations include enhancing security headers, publishing a security.txt file, and providing clearer incident response contacts to further strengthen their security posture and compliance.

70
100
39
70
80
85
17
legalcommerciallawbarristersuksingapore+3 more
WordPressYoast SEOJetpackGoogle Analytics+4
2026-07-02T07:13:54.473Z
osborneclarke.com favicon

Osborne Clarke LLP

osborneclarke.com

69
OtherUnited KingdomlargeMEDIUM

Osborne Clarke LLP is a well-established international legal practice with a history dating back to 1748. The firm operates across Europe, Asia, and the US, offering a broad range of legal services including banking and finance, corporate law, dispute resolution, ESG, intellectual property, and regulatory compliance. Their website reflects a professional and comprehensive digital presence, targeting businesses and professionals seeking expert legal counsel internationally. The firm positions itself as a trusted advisor with a strong emphasis on helping clients succeed in tomorrow's world. Technically, the website is built on Drupal 11, leveraging modern web technologies such as jQuery and privacy-focused analytics tools like Simple Analytics. The site is mobile-optimized, accessible, and SEO-friendly, with clear navigation and rich content. Cookie consent mechanisms and privacy policies are prominently implemented, demonstrating compliance with GDPR and other privacy regulations. From a security perspective, the site uses HTTPS with good SSL configuration and employs cookie consent banners. However, no explicit security policy or incident response contact information is published, and security headers are not visibly present in the HTML. No vulnerabilities or exposed sensitive data were detected. The WHOIS data for the domain is missing or unavailable, which is unusual for a reputable firm and warrants further verification. Overall, Osborne Clarke's website presents a strong business and technical profile with good privacy compliance and user experience. The main risk lies in the lack of publicly available WHOIS data and absence of explicit security policies, which should be addressed to enhance trust and transparency.

85
62
100
85
7
73
55
legalinternationallawfirmprofessionalservicesprivacy+3 more
Drupal 11jQueryAddToAny sharingCookieReports+1

Partner Domains:

wave.osborneclarke.com
partner
digitalregulation.osborneclarke.com
partner

+2 more partners

2026-07-02T07:13:32.522Z