Skip to main content

United Kingdom security reports

Browse 6,690 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

156127
Websites
130
Industries
113
Countries
52
Avg Score
Page 31 of 134|Showing 1501-1550 of 6690
walsingham.com favicon

Walsingham Support

walsingham.com

57
Non-profitUnited KingdommediumMEDIUM

Walsingham Support is a well-established UK-based charity providing personalized support services for individuals with learning disabilities, autism, brain injuries, and complex needs. With over 40 years of experience, the organization offers bespoke support solutions ranging from a few hours weekly to full 24/7 care. The website reflects a professional and consistent brand image, targeting individuals and families seeking specialized disability support. The charity emphasizes its commitment to quality of life and happiness for its clients. Technically, the website employs a modern technology stack including jQuery, Google Tag Manager, and a proprietary CMS (Grandad Digital). It is mobile-optimized, accessible, and includes cookie consent mechanisms aligned with GDPR requirements. Analytics tools such as Google Analytics and Hotjar are used with user consent. However, some security best practices such as explicit security headers and published security policies are missing. From a security perspective, the site uses HTTPS and manages cookie consent effectively, but lacks visible security policies and incident response contacts. The WHOIS data is unavailable, which raises concerns about domain registration legitimacy and consistency with the claimed 40-year history. No critical vulnerabilities or unsafe content were detected. Overall, the website is professional and trustworthy in content and design but would benefit from improved transparency in domain registration and enhanced security documentation to strengthen trust and compliance.

70
75
100
37
15
83
2
charitydisabilitysupportnon-profitlearningdisabilitiesautism+3 more
jQueryjQuery UIGoogle Tag ManagerGoogle Analytics+2
2026-07-10T07:13:33.156Z
highlandwholefoods.co.uk favicon

Highland Wholefoods Workers Cooperative Limited Inverness

highlandwholefoods.co.uk

54
RetailUnited KingdomsmallMEDIUM

Highland Wholefoods Workers Cooperative Limited Inverness operates as a cooperative retailer and wholesaler specializing in vegetarian, vegan, gluten-free, organic, ethical, and eco-friendly food and household products. Established since 1989, it serves the Highlands, Islands, and northeast Scotland with over 5,000 products, targeting families, businesses, and community groups. The business model focuses on ethical shopping and community engagement with physical showrooms and online ordering capabilities. Technically, the website is built on the Spanglefish platform, utilizing legacy JavaScript libraries such as jQuery 1.8.2 and jQuery UI 1.8.13, with assets hosted on Amazon S3. The site demonstrates basic mobile optimization and SEO practices but lacks modern security headers and uses outdated libraries, which pose security risks. Privacy and cookie policies exist but lack active consent mechanisms. Security posture is moderate; HTTPS is implied but no advanced security headers or incident response contacts are visible. The WHOIS lookup failed due to an invalid domain query, limiting verification of domain registration legitimacy. No critical vulnerabilities or malware indicators were found, but outdated libraries and missing security headers reduce the security score. Overall, the website is functional and trustworthy from a business perspective but requires technical and security improvements to enhance compliance, security posture, and user trust. Strategic recommendations include updating JavaScript libraries, implementing security headers, adding cookie consent mechanisms, and clarifying domain registration details.

70
47
60
100
15
68
2
organicvegangluten-freeethicalshoppingcooperative+4 more
jQuery 1.8.2jQuery UI 1.8.13Superfish menu pluginFancybox 1.3.4+2
2026-07-10T07:10:23.368Z
silvershieldwindscreens.co.uk favicon

Silver Shield Windscreens

silvershieldwindscreens.co.uk

50
TransportationUnited KingdomsmallMEDIUM

Silver Shield Windscreens is a UK-based company specializing in automotive glass repair and replacement services, including windscreen repairs, replacements, fleet services, specialist glazing, and ADAS recalibration. The company targets fleet owners, business owners, and private vehicle owners across England and Wales, emphasizing quality service at competitive prices with trained technicians and insurance claim support. The website presents a professional image with clear contact details and service descriptions. Technically, the website employs legacy technologies such as jQuery 1.8.3 and Modernizr 2.6.2, alongside Google Analytics and Tag Manager for tracking. The site is mobile-optimized with a cookie consent mechanism, but lacks visible modern security headers and uses an outdated JavaScript library, which may pose security risks. Performance is moderate, and SEO practices are adequately implemented. From a security perspective, the site uses HTTPS (assumed from external scripts loaded via HTTPS), but no explicit security headers were detected in the provided data. The cookie consent banner and privacy policies indicate GDPR compliance efforts, though no incident response or vulnerability disclosure information is present. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy, though the website content is consistent with a legitimate business. Overall, the website is functional and professional but would benefit from technical and security improvements, including updating libraries, implementing security headers, and clarifying domain registration status to enhance trust and compliance.

47
60
85
20
15
95
2
windscreenrepairwindscreenreplacementfleetservicesadasrecalibrationspecialistglazing+3 more
jQuery 1.8.3Google AnalyticsGoogle Tag ManagerModernizr 2.6.2+1
2026-07-10T07:09:34.977Z
bishoptonvets.co.uk favicon

Bishopton Veterinary Group

bishoptonvets.co.uk

65
HealthcareUnited KingdommediumMEDIUM

Bishopton Veterinary Group is an established independent veterinary practice based in Yorkshire, UK, with over 80 years of experience. The company provides a broad range of veterinary services including small animal care, farm animal services, pig herd health consulting, and equine veterinary care. They operate multiple branches across Yorkshire and offer 24-hour emergency cover, positioning themselves as a trusted regional veterinary provider. Their business model focuses on comprehensive animal healthcare with additional offerings such as a Lifetime Care Club to support preventative care budgeting for pet owners. Technically, the website is built on an ASP.NET WebForms platform with a mix of legacy and modern web technologies including jQuery, Google reCAPTCHA v3, and Slick Carousel. The site is mobile optimized with good SEO practices and a professional design. While the CMS appears proprietary or custom, the infrastructure supports a moderate performance level and basic accessibility features. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect its contact form from spam. However, it lacks some modern security headers and does not publish explicit security or incident response policies. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with a clear privacy policy and cookie consent mechanism. The WHOIS lookup failed due to querying a subdomain rather than the registered domain, but the website content and company registration details strongly indicate legitimacy. Overall, Bishopton Veterinary Group's website demonstrates a solid business presence with good technical and security practices. Strategic improvements in security headers, incident response transparency, and updating legacy libraries would further enhance their security posture and trustworthiness.

65
100
70
74
60
68
2
veterinarypetsfarmequinehealthcare+2 more
ASP.NET WebFormsjQuery 1.9.1AjaxControlToolkitSlick Carousel+4
2026-07-10T07:09:13.254Z
geobear.co.uk favicon

Geobear UK

geobear.co.uk

66
Real EstateUnited KingdommediumMEDIUM

Geobear UK is a specialized ground engineering company focused on providing fast, non-disruptive solutions for residential and commercial foundation problems caused by subsidence. The company positions itself as a niche expert in subsidence repair across the UK, targeting homeowners and commercial property owners. Their key services include subsidence repair, residential foundation stabilization, and infrastructure ground engineering. The website reflects a professional and consistent brand image with clear navigation and contact options, supporting their market position. Technically, the website is built on the HubSpot CMS platform, utilizing modern technologies such as Bootstrap for responsive design, Google Tag Manager for analytics management, and Cookiebot for privacy compliance. The site is mobile-optimized and demonstrates good SEO and accessibility practices. Hosting appears to be supported by Cloudflare, enhancing performance and security. From a security perspective, the website enforces HTTPS and employs cookie consent mechanisms that comply with GDPR. Security headers are partially detected or implied, and no critical vulnerabilities or exposed sensitive data were found in the content. The WHOIS data is privacy-protected, which is common for businesses of this type, and does not raise immediate trust concerns given the professional website presence. Overall, the website presents a low-risk profile with strong business credibility and good privacy compliance. Strategic recommendations include enhancing explicit security headers, continuous monitoring of third-party scripts, and ensuring robust form security to maintain and improve the security posture.

75
100
49
70
95
2
50
subsidencefoundationrepairgroundengineeringukconstruction+4 more
HubSpot CMSGoogle Tag ManagerCookiebotBootstrap+2

Partner Domains:

villaagare.geobear.com
subsidiary
underpinning.geobear.com
subsidiary

+3 more partners

2026-07-10T07:08:52.027Z
directvehicleglass.co.uk favicon

Direct Vehicle Glass

directvehicleglass.co.uk

46
TransportationUnited KingdommediumHIGH

Direct Vehicle Glass is a well-established UK-based company specializing in mobile windscreen repair and replacement services, primarily serving Liverpool, Warrington, Manchester, and the wider North West region. The company positions itself as a leading independent automotive glazing provider with a focus on quality and responsiveness. Their key services include private and commercial vehicle glass repair, fleet cover, and advanced driver assistance system (ADAS) calibration. The website reflects a medium-sized business with a professional online presence and multiple insurance partnerships that enhance trustworthiness. Technically, the website is built on WordPress and utilizes modern web technologies such as jQuery, Slick Carousel, and Google Analytics for tracking. The site is mobile-optimized with good SEO practices implemented via Yoast SEO. Performance is moderate, and accessibility is basic but functional. The site uses HTTPS with an excellent SSL configuration, though it lacks some security headers that could improve its security posture. From a security perspective, the site demonstrates good baseline practices such as HTTPS and no visible sensitive data exposure. However, it lacks published security policies, incident response information, and a cookie consent mechanism, which are important for GDPR compliance and user trust. No vulnerabilities or suspicious content were detected. The domain registration data aligns well with the business claims, indicating legitimacy and a strong trust foundation. Overall, the website is professional, credible, and secure enough for its business purpose but would benefit from enhanced privacy compliance and security transparency to improve user trust and regulatory adherence.

70
65
20
47
53
17
15
windscreenrepairvehicleglassmobileserviceadascalibrationfleetcover+4 more
jQuerySlick CarouselGoogle AnalyticsYoast SEO
2026-07-10T07:07:53.481Z
traffixuk.com favicon

Traffix Ltd

traffixuk.com

61
TransportationUnited KingdommediumMEDIUM

Traffix Ltd is a well-established UK-based company specializing in temporary traffic and event management services. Operating since 2005 with a domain registered in 2006, the company maintains a strong market position in the transportation sector, serving complex infrastructure projects, construction, highway maintenance, utilities, and high-profile events. Their service portfolio is comprehensive, supported by multiple strategically located depots and a 24/7 emergency callout service. The website reflects a professional and consistent brand image with clear navigation and relevant content targeting businesses and organizations requiring traffic management solutions in Central England and beyond. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, WPBakery Page Builder, and Slider Revolution. It employs Google Analytics and Facebook Pixel for analytics and marketing, and implements cookie consent mechanisms aligned with GDPR requirements. Hosting is provided by s2hosting.co.uk, and the site shows good mobile optimization and moderate performance. Security posture is solid with HTTPS enabled and reCAPTCHA on forms, though improvements could be made by enabling DNSSEC and adding security headers. No WAF or blocking mechanisms were detected, allowing full content access. The WHOIS data is consistent with the business claims, showing a long domain age and transparent registration without privacy protection, supporting legitimacy. Contact information is clearly presented with multiple phone numbers, emails, and physical addresses. Social media presence is active across major platforms, enhancing trust and outreach. Overall, Traffix Ltd demonstrates a mature digital presence with good security and privacy compliance, making it a trustworthy and professional service provider in its industry.

60
100
85
27
45
85
2
trafficmanagementeventmanagementtransportationukbusinesswordpress+3 more
WordPressPHPYoast SEO pluginWPBakery Page Builder+7
2026-07-10T07:07:42.790Z
satbill.co.uk favicon

Symbiosys Business Solutions Ltd

satbill.co.uk

66
TelecommunicationsUnited KingdommediumMEDIUM

Symbiosys Business Solutions Ltd operates the SATbill platform, a specialized satellite airtime billing solution designed for satellite service providers and operators worldwide. The company offers a comprehensive software product that supports billing for multiple providers, call types, and value-added services, with strong customization and integration capabilities. Their market position is supported by a global client base, multi-entity billing features, and significant invoicing volume, positioning them as a key player in the satellite telecommunications billing niche. Technically, the website is built on the HubSpot CMS platform, leveraging modern web technologies including Google Fonts, jQuery, and various analytics and marketing tools such as Google Analytics, Hotjar, and LinkedIn Insight. The site is well-optimized for mobile and accessibility, with good SEO practices and a professional design that enhances user experience. From a security perspective, the site enforces HTTPS, uses reCAPTCHA on forms, and benefits from HubSpot's security headers and infrastructure. However, the absence of explicit security policy pages and vulnerability disclosure mechanisms suggests room for improvement in transparency and incident response readiness. The WHOIS data is missing or indicates the domain may not be registered, which raises concerns about domain legitimacy despite the professional website content. Overall, the website presents a trustworthy and professional front for a specialized business solution, but the lack of WHOIS registration data and explicit security policies slightly reduce the overall trust score. Strategic recommendations include establishing clear security and incident response documentation, verifying domain registration, and enhancing transparency to strengthen stakeholder confidence.

44
70
60
100
75
17
83
satellitebillingtelecommunicationssoftwaresatcom+2 more
HubSpot CMSGoogle FontsjQuerySlick Carousel+7
2026-07-10T07:07:26.842Z
B

Banana Dance Ltd

bananadance.com

56
RetailUnited KingdomsmallMEDIUM

Banana Dance Ltd is a specialized antiques dealer based in London, focusing on Clarice Cliff and Art Deco ceramics, glass, and general antiques. The company operates both a physical presence in the Northcote Road Antiques Market and an online platform showcasing a wide range of collectible items. Their market position is that of a long-established and leading specialist in their niche, targeting collectors and enthusiasts of vintage ceramics and antiques. Technically, the website employs a traditional tech stack with older versions of jQuery and jQuery UI, alongside Google Maps API and various jQuery plugins for UI enhancements. While the site is functional and moderately optimized for performance and SEO, mobile optimization and accessibility are basic and could be improved. The site uses HTTPS and Google Tag Manager for analytics but lacks modern security headers and updated libraries, which could pose security risks. From a security perspective, the site shows moderate maturity with HTTPS enabled and no exposed sensitive data. However, the absence of security headers, outdated JavaScript libraries, and missing privacy and cookie policies indicate compliance and security gaps. The lack of WHOIS data reduces domain trustworthiness, although the website content and contact information appear professional and legitimate. Overall, Banana Dance Ltd presents a credible and professional online presence for their antiques business but should address privacy compliance, update technical components, and enhance security measures to improve trust and reduce risk.

100
67
75
60
17
35
25
antiquesclaricecliffartdecoceramicscollectables+3 more
jQuery 1.7.1jQuery UI 1.8.11Google Maps API v3Modernizr 2.5.3+4
2026-07-10T07:06:28.250Z
elfrida.com favicon

The Elfrida Society

elfrida.com

48
Non-profitUnited KingdomsmallHIGH

The Elfrida Society is a well-established non-profit organization dedicated to supporting individuals with learning disabilities, autism, and learning difficulties. With over 100 years of history, it provides advocacy, community engagement, inclusive sports, and various support services primarily in Islington and London. The website reflects a professional and community-focused charity with clear mission, vision, and values. The organization maintains active social media channels and offers multiple ways for the public to engage, donate, or volunteer. Technically, the website employs a modern tech stack including Bootstrap, jQuery, and various UI and animation libraries. It is mobile-optimized with good SEO and accessibility basics, though some accessibility features could be enhanced. The site uses HTTPS with a strong SSL configuration and implements cookie consent mechanisms, reflecting good privacy compliance. However, security headers are missing, and no explicit security policy or incident response contact is provided. From a security perspective, the site shows a mature posture with no visible vulnerabilities or exposed sensitive data. The absence of WHOIS registration data is a concern, as it reduces transparency and trust, though the website content and business information appear legitimate and consistent with a reputable charity. No signs of WAF blocking or security challenges were detected, allowing full content access. Overall, the site scores well on content quality, technical implementation, and security posture, with minor penalties for missing WHOIS data and security headers. Strategic improvements in security headers, incident response transparency, and WHOIS data clarity would enhance trust and compliance.

-
75
85
57
15
17
53
non-profitlearningdisabilitiesautismsupportcommunityadvocacy+2 more
BootstrapjQueryAOS (Animate On Scroll)Font Awesome+8
2026-07-09T07:27:05.064Z
kscleaning.com favicon

KS Cleaning Contractors Ltd

kscleaning.com

48
OtherUnited KingdommediumHIGH

KS Cleaning Contractors Ltd is a well-established commercial cleaning service provider based in Somerset, UK, with over 45 years of experience since its founding in 1980. The company offers a broad range of cleaning services including office, school, healthcare, retail, hospitality, and builders cleans. Their business model emphasizes directly employed, DBS-checked teams and a proprietary client portal that provides audit trails with photo evidence and GPS check-ins, enhancing transparency and client trust. The website is professionally designed with clear navigation and strong local market positioning, targeting property managers, facilities managers, and developers in Somerset and the wider South West region. Technically, the website employs modern web technologies including Google Tag Manager for analytics and tracking, uses SVG graphics for branding, and is mobile-optimized with fast performance. However, no CMS or hosting provider details were detected. The site lacks visible security headers and cookie consent mechanisms, which are areas for improvement. The absence of WHOIS registration data for the domain is a notable anomaly that affects trustworthiness, although the website content and business information appear consistent and professional. From a security perspective, the site enforces HTTPS and does not expose sensitive data or vulnerable libraries. The client portal's audit features indicate a mature approach to operational security and accountability. However, the lack of published security policies, incident response contacts, and vulnerability disclosure mechanisms suggests room for enhancement in security posture and compliance. Overall, the website scores well in content quality and business credibility but is moderately impacted by privacy compliance and WHOIS inconsistencies. Strategically, KS Cleaning should address the WHOIS registration anomaly, implement standard security headers, introduce cookie consent to comply with GDPR, and publish…

40
40
60
52
60
53
2
commercialcleaningsomersetcleaningservicesdbs-checkedclientportal+3 more
Google Tag ManagerCustom client portal softwareSVG graphicsCSS stylesheets+1
2026-07-09T07:26:16.976Z
cdsurveys.com favicon

CD SURVEYS LTD

cdsurveys.com

56
Real EstateUnited KingdomsmallMEDIUM

CD SURVEYS LTD is a professional land surveying and site engineering service provider established in 2001 in the United Kingdom. The company offers a comprehensive range of surveying services including land surveying, site engineering, measured building surveying, 3D laser scanning, and drone survey systems. Their website reflects a well-structured and professional digital presence targeting businesses and professionals in real estate and transportation sectors. The company maintains active social media profiles on Facebook, Twitter (X), LinkedIn, and Instagram, enhancing their market reach and customer engagement. Technically, the website is built on WordPress using Elementor and integrates modern SEO tools like Rank Math. It employs Google Tag Manager and Google Analytics for tracking and marketing purposes. The site is hosted with DNS managed by Cloudflare, ensuring reliable DNS resolution. Performance and mobile optimization are good, though accessibility features are basic. The website uses HTTPS with a good SSL configuration but lacks DNSSEC and security headers, which are recommended for enhanced security. From a security perspective, the site has no visible security policy, incident response information, or vulnerability disclosure mechanisms. Privacy and cookie policies are absent, indicating compliance gaps with GDPR and other privacy regulations. Contact information is clearly presented, but no forms were detected in the analyzed content. The domain WHOIS data is consistent with the business claims, showing a long-standing registration since 2001, which supports the legitimacy of the company. Overall, CD SURVEYS LTD presents a trustworthy and professional online presence with room for improvement in privacy compliance and security hardening. Strategic enhancements in these areas would strengthen their security posture and regulatory compliance, thereby increasing customer trust and reducing risk.

37
100
65
70
25
68
2
landsurveyingsiteengineeringprofessionalservices3dlaserscanningdronesurveys
WordPressElementorGoogle Tag ManagerGoogle Analytics+1
2026-07-09T07:26:00.973Z
ghekko.com favicon

Ghekko

ghekko.com

47
TelecommunicationsUnited KingdommediumHIGH

Ghekko Group is a medium-sized, established telecommunications hardware supplier and service provider with a global reach through facilities in the UK, Ireland, and the USA. The company specializes in supplying, buying back, repairing, and providing technical services for telecom equipment including phones, headsets, networking, and optical transmission hardware. Their market position is strong within the telecommunications sector, targeting business customers requiring cost-effective and efficient communications hardware solutions. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and uses Bootstrap for responsive design. It integrates Google Analytics and Google reCAPTCHA for analytics and security respectively. The site is mobile-optimized and SEO-friendly, though accessibility features are basic. Performance is moderate, with room for improvement in security headers and accessibility. From a security perspective, the site enforces HTTPS and uses reCAPTCHA on forms, indicating good baseline security practices. However, the absence of explicit security policies, incident response information, and missing WHOIS domain registration data reduce overall trustworthiness. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website and business present a professional and trustworthy front with solid technical implementation but would benefit from improved transparency in domain registration and enhanced security documentation to strengthen compliance and trust.

37
20
65
75
15
17
68
telecommunicationshardwarenetworkingtelecomequipmentrepair+2 more
WordPressYoast SEO pluginjQueryBootstrap+2

Partner Domains:

www.ghekkonetworks.com
partner
www.ghekkotechnology.com
partner
2026-07-09T07:25:39.582Z
leelonglands.co.uk favicon

Lee Longlands

leelonglands.co.uk

63
RetailUnited KingdommediumMEDIUM

Lee Longlands is a well-established UK-based furniture retailer with over 120 years of history, specializing in sofas, dining, bedroom furniture, and garden furnishings. The company operates both online and through multiple physical showrooms across the UK, offering services such as interest free credit, white glove delivery, and interior design consultation. Their market position is supported by strong trust indicators including thousands of positive Trustpilot reviews and a consistent brand presence. Technically, the website employs a modern tech stack including jQuery, Owl Carousel, Google Fonts, and integrates marketing and analytics tools such as Google Tag Manager, Facebook Pixel, and Trustpilot widgets. The site is mobile optimized with good SEO practices and a moderate performance profile. However, some security best practices like security headers are missing, though HTTPS is properly enforced and CSRF tokens are implemented. From a security perspective, the site demonstrates a reasonable posture with encrypted communications and privacy compliance evidenced by clear privacy and cookie policies with consent mechanisms. There is no visible incident response or vulnerability disclosure information, which could be improved. The WHOIS data query failed due to an invalid domain format, but this appears to be a technical querying error rather than a legitimacy concern. Overall, Lee Longlands presents a trustworthy and professional online presence with solid business credibility and privacy compliance. Strategic improvements in security headers and incident response transparency would enhance their security posture further.

65
20
70
77
90
17
80
furnitureretailsofasbedroomdining+5 more
jQueryGoogle FontsTypekit FontsOwl Carousel+5
2026-07-09T07:24:24.669Z
stratusconsultants.com favicon

Stratus Consultants Ltd

stratusconsultants.com

47
FinanceUnited KingdomsmallHIGH

Stratus Consultants Ltd is a Glasgow-based professional services firm specializing in accounting, finance, software solutions, and artificial intelligence consulting. Established in 2009, the company targets small business owners, private individuals, and startups, offering tailored financial and software services to support business growth and tax optimization. The website reflects a solid market position with clear service offerings and client testimonials, emphasizing local expertise and personalized consulting. Technically, the website is built on WordPress using popular plugins such as Elementor and Slider Revolution, with a moderate performance profile and good mobile optimization. The site uses HTTPS and standard web technologies but lacks advanced security headers and DNSSEC, indicating room for improvement in security hardening. From a security perspective, the site demonstrates basic best practices such as HTTPS and domain transfer protection but lacks published security policies, incident response contacts, and privacy compliance documentation. No WAF or blocking mechanisms are detected, and the site is fully accessible. Overall, the website presents a trustworthy and professional business presence with moderate technical maturity and security posture. Strategic enhancements in privacy compliance, security headers, and DNS security would strengthen the site’s risk profile and user trust.

20
57
75
70
35
15
25
accountingfinancesoftwaresolutionartificialintelligenceconsulting+2 more
WordPressPHPjQuerySlider Revolution+5
2026-07-09T07:23:52.657Z
R

Red Sky Management LTD

redskymanagement.co.uk

65
OtherUnited KingdomsmallMEDIUM

Red Sky Management LTD is a small UK-based company specializing in elite sport management combined with business performance coaching. Founded in 2003 by former Scotland Rugby Internationalists, the company targets businesses and elite sports professionals seeking integrated management and coaching services. The website is professionally designed using the Squarespace platform, featuring clear branding and consistent content that reflects the company's niche market position. Technically, the website leverages modern web technologies including Squarespace CMS, Typekit fonts, and standard JavaScript and CSS. The site is mobile-optimized with good SEO practices and moderate performance. Security measures include HTTPS with HSTS enabled and a GDPR-compliant cookie consent banner, although some security headers and privacy documentation are missing. The security posture is solid with no evident vulnerabilities or exposed sensitive data. However, the absence of a privacy policy, terms of service, and incident response information represents compliance gaps. The WHOIS data could not be retrieved due to query limits, limiting domain age and registrant verification. Overall, the site appears trustworthy and professional but would benefit from enhanced compliance documentation and security headers. Strategic recommendations include adding comprehensive privacy and terms policies, implementing additional security headers, publishing incident response contacts, and regularly auditing third-party scripts. These steps will improve compliance, security posture, and user trust, supporting the company's professional image and operational resilience.

70
54
60
100
45
17
95
sportsmanagementperformancecoachingbusinesscoachingelitesportsquarespace
SquarespaceTypekit fontsJavaScriptCSS3
2026-07-09T07:23:36.634Z
W

webwide translations Ltd trading as Freed Translations

freedtranslations.com

48
TechnologyUnited KingdomsmallHIGH

Freed Translations is a UK-based small business specializing in professional translation and localization services with over 20 years of industry experience. Their core offering is a guaranteed risk-free translation service supported by a detailed 5-step quality assurance process. The company targets businesses requiring accurate and reliable translations across sectors such as IT, Quality/Six Sigma, Food & Drink, Education & Tourism, and Marketing. The website presents a professional image with clear navigation and comprehensive service descriptions. Technically, the website uses a standard modern JavaScript stack including jQuery and cookie consent tools, with good mobile optimization and SEO practices. However, there is no evidence of advanced frameworks or CMS platforms. Performance is moderate, and accessibility is basic but functional. Security posture is average with no visible HTTP security headers and unknown SSL configuration, though forms are secured with required fields. From a security perspective, the site lacks explicit security policies, incident response contacts, and vulnerability disclosures. The WHOIS data is missing or indicates the domain is unregistered or expired, which raises concerns about domain legitimacy and trustworthiness. Despite this, the website content is professional and safe, with clear contact information and social media presence. Overall, Freed Translations offers a credible business service with room for improvement in security transparency and domain registration legitimacy. Strategic recommendations include enhancing security headers, publishing comprehensive policies, and resolving domain registration inconsistencies to improve trust and compliance.

52
70
-
75
15
83
17
translationrisk-freelocalizationprofessionalserviceslanguageservices
jQuery 3.1.0jQuery Validate 1.16.0jQuery Modal 0.8.0CookieConsent 3.0.3
2026-07-09T07:23:15.319Z
gtwholesale.co.uk favicon

Group Tyre Wholesale Limited

gtwholesale.co.uk

55
TransportationUnited KingdommediumMEDIUM

Group Tyre Wholesale Limited is a UK-based tyre wholesaler established in 2010, specializing in supplying a wide range of tyres for cars, vans, and 4x4 vehicles. The company targets automotive trade professionals and garages, offering trade online ordering, account management, and employee training resources. Their market position is supported by over 14 years of operation, a large stock inventory, and a dedicated delivery fleet. Technically, the website is built on WordPress using the Divi theme, leveraging common web technologies such as jQuery and PHP. The site demonstrates moderate performance and good mobile optimization but could improve accessibility and SEO. Security posture is solid with HTTPS and DNSSEC enabled, though additional HTTP security headers and published security policies would enhance trust. Privacy compliance is well addressed with clear cookie and privacy policies and a consent mechanism. Overall, the website is professional and trustworthy, with clear business information and contact channels, though no direct company emails were found. Strategic recommendations include enhancing security headers, publishing incident response information, and improving SEO and accessibility.

47
70
85
20
2
50
85
tyreswholesaleruktradeautomotive+1 more
WordPressDivi ThemejQueryPHP

Partner Domains:

gtw3.thevirtualwarehouse.co.uk
partner
grouptyrewholesale.astute-elearning.com
partner

+1 more partners

2026-07-09T07:22:32.585Z
chartwell-group.com favicon

Chartwell Group Limited

chartwell-group.com

60
Real EstateUnited KingdomsmallMEDIUM

Chartwell Group Limited is a UK-based luxury renovation, construction, and development company with over two decades of experience, serving an international clientele. The company positions itself as a premium service provider specializing in designing dream homes and high-end property projects. Their website reflects a professional digital presence built on WordPress, enhanced with SEO tools and social media integration, targeting affluent homeowners and property developers. Technically, the site uses modern web technologies including Google Tag Manager and Font Awesome, hosted likely via GoDaddy infrastructure. Performance and mobile optimization are adequate, though accessibility features are basic. From a security perspective, the website employs HTTPS but lacks advanced DNS security measures like DNSSEC and does not implement security headers, which could expose it to certain web-based attacks. The absence of privacy and cookie policies indicates compliance gaps with GDPR and other privacy regulations. No incident response or vulnerability disclosure mechanisms are present, limiting transparency in security management. The presence of a suspicious external domain in scripts raises minor concerns. Overall, the security posture is moderate but requires improvements to meet best practices. The business credibility is supported by consistent WHOIS data, domain age, and active social media presence. However, the lack of direct contact emails or phone numbers on the homepage reduces immediate trust signals. The website content is relevant and professionally presented, with no adult or questionable content detected, making it safe for general audiences. Strategic recommendations include implementing comprehensive privacy and cookie policies, enabling DNSSEC, adding security headers, and providing clear security contact information to enhance trust and compliance.

47
100
85
75
2
65
35
luxuryrenovationconstructiondevelopmentbritishcompanyinternational+1 more
WordPress 5.7.15Yoast SEO pluginGoogle Tag ManagerFont Awesome 4.5.0+3
2026-07-09T07:22:21.946Z
W

Webber Design Ltd

webber-design.com

53
OtherUnited KingdomsmallMEDIUM

Webber Design Ltd is a small, established graphic and web design company based in Newport, South Wales, operating since 2005. They offer a comprehensive range of creative services including bilingual web design, branding, print design, commercial photography, animation, and SEO services. The company targets a broad audience from local SMEs to international brands, positioning itself as a trusted and experienced design studio with a strong local presence. The website reflects a professional and consistent brand image with clear navigation and rich content. Technically, the site uses modern JavaScript libraries such as jQuery and Swiper.js, and integrates Google Analytics with a cookie consent mechanism, indicating a moderate level of digital maturity. Security posture is generally good with HTTPS enforced and form validation implemented, but lacks some security headers and explicit incident response information. The absence of WHOIS domain registration data is a notable concern, potentially indicating privacy protection or domain registration issues, which slightly reduces overall trustworthiness. Overall, the website is well-designed, user-friendly, and compliant with privacy regulations, but would benefit from enhanced security practices and domain registration transparency.

70
59
80
40
50
45
2
webdesigngraphicdesignbrandinglogodesigncommercialphotography+3 more
jQuerySwiper.jsFontAwesomeGoogle Fonts+1

Partner Domains:

webber-photo.com
partner
2026-07-09T07:22:16.624Z