Skip to main content

United Kingdom security reports

Browse 7,121 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157364
Websites
130
Industries
113
Countries
52
Avg Score
Page 116 of 143|Showing 5751-5800 of 7121
boomy.co.uk favicon

Boomy Web Company

boomy.co.uk

62
TechnologyUnited KingdomsmallMEDIUM

Boomy Web Company is a small UK-based web design and marketing agency specializing in custom WordPress websites, eCommerce solutions, and digital marketing services. The company targets businesses and individuals seeking modern, mobile-responsive, and Google-friendly websites, primarily serving the Newport and Shropshire areas. Their market position is that of a local specialist with a focus on quality and customer experience. Technically, the website is built on WordPress using the Genesis Framework and Yoast SEO plugin, incorporating modern JavaScript libraries such as jQuery and ScrollMagic. The site is mobile-optimized and demonstrates good SEO practices, though performance is moderate. HTTPS is properly configured, but some security headers are missing, and there is no cookie consent mechanism, which impacts privacy compliance. From a security perspective, the site shows a solid baseline with HTTPS and no visible vulnerabilities or exposed sensitive data. However, the absence of security policies, incident response information, and terms of service pages indicates room for improvement in governance and compliance. The WHOIS lookup failed due to domain naming issues, which slightly reduces trustworthiness but does not negate the legitimacy of the business as evidenced by the professional website. Overall, Boomy presents a professional and trustworthy web presence with minor gaps in privacy compliance and security best practices. Strategic improvements in cookie consent, security headers, and publishing governance documents would enhance their security posture and compliance standing.

50
53
17
60
75
65
100
webdesignwordpresscustomwebsitesecommercemarketing+2 more
WordPressYoast SEO pluginjQueryScrollMagic+1
2025-07-21T23:32:15.968Z
hiddenhearing.co.uk favicon

Hidden Hearing UK

hiddenhearing.co.uk

66
HealthcareUnited KingdomlargeMEDIUM

Hidden Hearing UK is a well-established healthcare provider specializing in hearing tests and hearing aids across the United Kingdom. The company operates over 280 clinics and offers a range of services including free hearing tests, hearing aid sales, ear wax removal, and hearing aid maintenance. The website reflects a professional healthcare brand with consistent branding and a strong customer rating, positioning it as a trusted player in the UK hearing healthcare market. The parent company is likely Demant A/S, a known global hearing healthcare group, as indicated by asset URLs and branding. Technically, the website employs a modern technology stack including Google Tag Manager, Visual Website Optimizer, and Experian address validation services. It uses Azure CDN for hosting and demonstrates good mobile optimization, accessibility, and SEO practices. The site includes comprehensive cookie consent mechanisms and privacy compliance features, reflecting a mature digital infrastructure. From a security perspective, the site enforces HTTPS and uses cookie consent banners with granular controls. While explicit security headers were not fully visible in the provided data, the overall security posture is strong with no visible vulnerabilities or exposed sensitive data. However, the WHOIS lookup failed due to querying an invalid subdomain (www prefix), limiting domain registration data availability. Despite this, the domain appears legitimate based on website content and branding. Overall, Hidden Hearing UK presents a secure, compliant, and professionally managed online presence suitable for its healthcare service offerings. Strategic recommendations include enhancing security header implementation, publishing a formal security policy, and maintaining regular audits of third-party scripts to sustain security and compliance.

75
83
17
87
-
85
100
hearinghealthcarehearingaidshearingtestuk+2 more
Google Tag ManagerVisual Website Optimizer (VWO)ClickDimensions AnalyticsCookie Information Consent Management+3

Partner Domains:

audika.com.au
partner
hearinglife.ca
partner

+1 more partners

2025-07-21T22:24:58.535Z
virginballoonflights.co.uk favicon

Virgin Balloon Flights

virginballoonflights.co.uk

56
TransportationUnited KingdommediumMEDIUM

Virgin Balloon Flights is a well-established UK-based company specializing in hot air balloon rides and related experience gifts. Positioned as the UK's leading passenger balloon rides operator, the company offers flights from over 100 locations nationwide. Their business model focuses on selling adventure experiences and gift vouchers through a professionally designed and user-friendly website. The company demonstrates strong branding consistency and trust indicators including CAA certification and a long operational history since 1994. Technically, the website employs modern web technologies such as HTMX, Alpine.js, Google Tag Manager, and integrates marketing and analytics tools like Mailchimp and Ahrefs Analytics. The site is mobile-optimized, SEO-friendly, and provides a smooth user experience. While HTTPS is enforced, the site could improve security posture by implementing additional HTTP security headers. From a security perspective, the website shows good practices including secure forms, cookie consent management, and no visible vulnerabilities or exposed sensitive data. However, the absence of explicit security policies or incident response information is noted. The WHOIS data for the www subdomain is unavailable due to domain naming rules, but the overall legitimacy of the domain and business is supported by consistent branding and contact information. Overall, Virgin Balloon Flights presents a low-risk profile with a strong market position and a mature digital presence. Strategic recommendations include enhancing security headers, publishing security policies, and continuous monitoring of third-party scripts to maintain security and compliance.

70
85
83
40
2
30
52
balloonflightshotairballoonadventureexperiencegiftsuktravel+1 more
JavaScriptHTMXGoogle Tag ManagerGoogle Analytics+3

Partner Domains:

booking.virginballoonflights.co.uk
service
www.boomy.co.uk
partner
2025-07-21T22:07:06.390Z
virginexperiencedays.co.uk favicon

Virgin Experience Days Ltd.

virginexperiencedays.co.uk

67
RetailUnited KingdomlargeMEDIUM

Virgin Experience Days Ltd. operates a UK-based e-commerce platform specializing in experience gifts, offering over 5,000 experiences ranging from supercars and spa days to dining and adventure activities. The company is positioned as a leading provider in the UK market with a broad target audience including families and gift buyers. The website demonstrates a mature digital infrastructure leveraging modern technologies such as Next.js, React, and marketing tools like Google Tag Manager and Klaviyo, indicating a well-developed digital presence. Security posture is generally good with HTTPS enforced and no exposed sensitive data, though the absence of security headers and explicit privacy and cookie policies suggests room for improvement in compliance and security best practices. Overall, the site is professional, trustworthy, and user-friendly, with a high-quality design and clear navigation. The WHOIS data could not be retrieved due to a query on the www subdomain, which is invalid for .uk domains, but the website content and branding strongly support legitimacy. Strategic recommendations include enhancing security headers, publishing comprehensive privacy and cookie policies, and providing clear contact and incident response information to strengthen trust and compliance.

55
68
17
75
77
65
100
experiencegiftsuke-commerceadventurespa+3 more
Next.jsReactGoogle Tag ManagerKlaviyo+1
2025-07-21T22:06:27.144Z
eighty-days.com favicon

80 DAYS

eighty-days.com

69
HospitalityUnited KingdommediumMEDIUM

80 DAYS is a well-established, award-winning creative and digital marketing agency specializing in the hospitality and travel sectors. Founded in 2002 and operating from multiple offices including Edinburgh, London, Málaga, and Dubai, the company serves a global clientele of respected hotel and travel brands. Their service offerings encompass brand development, website creation, digital marketing, social media management, training, and insights, positioning them as a comprehensive partner in travel marketing. The company holds notable certifications such as the King's Award for Enterprise 2025, B Corp certification, and is a Google Premier Partner for over a decade, underscoring their market credibility and expertise. Technically, the website employs a modern technology stack including Google Tag Manager, Google reCAPTCHA v3, Visual Website Optimizer, Agile CRM, and Cloudflare for security and performance. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Security measures include HTTPS enforcement, bot management, CSRF protection, and a cookie consent mechanism, reflecting a mature security posture. However, explicit security policies and incident response contacts are not publicly disclosed, representing an area for improvement. The website exhibits extensive use of analytics and marketing tools, with comprehensive cookie and privacy policies aligned with GDPR compliance. Contact information is clearly presented, including verified company email, phone number, and physical address. Despite the absence of WHOIS registration data, the overall digital presence and business information support the legitimacy of the entity. The site content is professional, safe, and targeted at a general audience within the hospitality and travel marketing industry.

55
83
17
75
62
80
100
creativeagencydigitalmarketinghospitalitytravelhotelmarketing+3 more
Google Tag ManagerGoogle reCAPTCHA v3Visual Website Optimizer (VWO)Agile CRM+5
2025-07-21T19:53:32.664Z
laneshealth.com favicon

Lanes Health

laneshealth.com

64
HealthcareUnited KingdommediumMEDIUM

Lanes Health is a well-established family-owned healthcare company with over 90 years of experience in manufacturing and distributing OTC medicines, food supplements, natural products, and confectionery. The company maintains a strong market presence in the UK and internationally through a portfolio of trusted brands such as Olbas, Jakemans, Kalms, and others. Their website reflects a professional and consistent brand image, targeting consumers, pharmacists, and retailers seeking quality health and wellbeing products. Technically, the website employs modern web technologies including HTML5, CSS3, JavaScript, jQuery, and integrates Google Analytics and Tag Manager with privacy-conscious configurations such as IP anonymization. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. However, some technical improvements could be made, such as implementing security headers and enhancing accessibility features. From a security perspective, the website uses HTTPS with a strong SSL configuration and includes cookie consent mechanisms aligned with GDPR requirements. No critical vulnerabilities or exposed sensitive data were detected in the content. However, the absence of WHOIS registration data for the domain raises concerns about domain legitimacy and trustworthiness, despite the professional appearance and business information presented. Overall, the website is functional, secure, and compliant with privacy standards, but the domain registration inconsistency warrants further investigation. Strategic recommendations include improving security headers, publishing explicit security and incident response policies, and verifying domain registration details to enhance trust and credibility.

90
73
17
85
82
70
20
healthcarefamilybusinessotcmedicinesnaturalproductssupplements+2 more
HTML5CSS3JavaScriptjQuery+4
2025-07-17T17:48:16.463Z
businessdailygroup.co.uk favicon

Business Daily Group Limited

businessdailygroup.co.uk

52
TransportationUnited KingdomsmallMEDIUM

Business Daily Group Limited is a UK-based business support company specializing in helping ambitious organizations grow across multiple sectors including rail, facilities management, and hydrogen industries. The company offers a comprehensive suite of services such as business advice, marketing, media publishing, recruitment, and community building. Their market position is that of a trusted partner to hundreds of clients, with a strong focus on profile enhancement and sector-specific expertise. The website reflects a professional and consistent brand image, targeting businesses seeking growth and market expansion. Technically, the website is built on WordPress using Elementor and Yoast SEO plugins, indicating a modern and maintainable infrastructure. The site is mobile-optimized with good SEO practices, though accessibility features are basic. Performance is moderate with no critical technical issues detected. The absence of advanced analytics or tracking scripts suggests a minimal user tracking approach. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks important security headers and cookie consent mechanisms, which are recommended for GDPR compliance and enhanced security posture. No vulnerabilities or exposed sensitive data were detected. The WHOIS lookup for the 'www' subdomain failed due to domain naming rules, but the main domain appears legitimate with clear company registration details. Overall, the website presents a low-risk profile with good business credibility and technical implementation. Strategic improvements in security headers, privacy compliance, and incident response documentation would further strengthen the security posture and trustworthiness.

25
35
2
55
57
65
100
businesssupportmarketingmediarecruitmentrailindustry+2 more
WordPressElementorYoast SEOjQuery

Partner Domains:

rbdrailrecruiter.com
partner
fmbusinessdaily.com
partner

+1 more partners

2025-07-17T17:46:15.162Z
aijmagazine.co.uk favicon

AIJ Magazine

aijmagazine.co.uk

60
ManufacturingUnited KingdomsmallMEDIUM

AIJ Magazine is a specialized media publication serving the Guild of Architectural Ironmongers and related professionals in the UK construction and manufacturing sectors. The website provides industry news, features, opinions, and digital editions, positioning itself as a niche authoritative source within its market. The business operates under the parent company Atom and has been active since 2020, with consistent branding and good content quality tailored to its professional audience. Technically, the website is built on WordPress with a modern tech stack including Yoast SEO, WP Rocket, and various JavaScript libraries for enhanced user experience and performance. Hosting is provided by 123-Reg Limited, a reputable registrar and hosting provider. The site demonstrates good mobile optimization, SEO practices, and fast loading times, contributing to a positive user experience. From a security perspective, the site enforces HTTPS and uses some security plugins but lacks explicit security headers and published security policies. No cookie consent mechanism is present, which may impact privacy compliance. No incident response or vulnerability disclosure information is available, indicating room for improvement in security transparency and readiness. Overall, the website is professional, trustworthy, and well-maintained, with moderate security posture and privacy compliance. Strategic enhancements in security headers, privacy mechanisms, and incident response documentation would strengthen its risk profile and compliance standing.

70
53
2
40
75
60
100
architecturalironmongeryindustrymagazineconstructionguildmedia+1 more
WordPressYoast SEO pluginWP RocketjQuery+5
2025-07-17T17:44:28.944Z
gai.org.uk favicon

Guild of Architectural Ironmongers (GAI)

gai.org.uk

70
ManufacturingUnited KingdommediumMEDIUM

The Guild of Architectural Ironmongers (GAI) is a well-established UK-based not-for-profit professional association representing the architectural ironmongery sector. The organization provides education, technical guidance, membership services, and industry advocacy, positioning itself as a leading trade body in its niche. The website reflects a mature digital presence with comprehensive content targeting professionals, manufacturers, and specifiers within the architectural ironmongery industry. The business model focuses on member support, education, and industry standards promotion. Technically, the website is built on a legacy ASP.NET WebForms platform enhanced with Telerik UI components and modern analytics tools such as Google Analytics and Microsoft Application Insights. The site is mobile-optimized with good navigation and content structure, though some modernization opportunities exist. Security posture is solid with HTTPS enforced and telemetry implemented, but could be improved by adding explicit security headers and a public security policy. Overall, the site demonstrates a high level of professionalism and trustworthiness with clear privacy and cookie policies, active social media presence, and no signs of blocking or malicious activity. The domain age and WHOIS data support the legitimacy of the organization. Strategic recommendations include enhancing security headers, updating legacy components, and publishing a vulnerability disclosure policy to further strengthen trust and compliance.

75
88
17
85
52
60
100
architecturalironmongerytradeassociationeducationmembershiptechnicalguidance+2 more
Microsoft ASP.NET WebFormsjQueryTelerik UI controlsGoogle Analytics+3
2025-07-17T17:32:17.610Z
L

London Stock Exchange Group (LSEG)

fx.com

73
FinanceUnited KingdomenterpriseMEDIUM

The website represents FXall, a comprehensive electronic FX trading platform operated by the London Stock Exchange Group (LSEG). It offers a full suite of FX trading services including spot, forwards, swaps, NDFs, and options with access to a broad liquidity pool and post-trade processing capabilities. The platform targets institutional clients such as asset managers, hedge funds, corporates, and banks, positioning itself as a leading solution in the FX electronic trading market. The site is professionally designed, well-branded, and provides rich content and resources to support its users. Technically, the website leverages modern web technologies including jQuery, Adobe Experience Manager CMS, Adobe DTM for tag management, and Qualtrics for user feedback and analytics. The site is mobile optimized, accessible, and SEO friendly. Security posture is strong with HTTPS enforced, secure login mechanisms, and no visible vulnerabilities. Privacy and cookie policies are comprehensive and GDPR compliant, though direct contact emails and phone numbers are not publicly listed, relying instead on a secure contact form. Overall, the site demonstrates a mature digital infrastructure and a strong security posture appropriate for a financial services platform. The absence of WHOIS data is noted but likely due to privacy or registrar restrictions and does not detract from the site's legitimacy given the strong brand and trust indicators. The platform is well-positioned in the market with a clear business model and target audience. Strategic recommendations include enhancing visible security disclosures such as incident response contacts and vulnerability disclosure policies, and providing direct contact information to improve user trust and support accessibility.

70
68
17
80
100
65
100
fxtradingelectronictradingplatformfinancialserviceslsegcapitalmarkets+3 more
jQuery 3.4.1Adobe DTM (Dynamic Tag Manager)Qualtrics DXJSAEM (Adobe Experience Manager) CMS

Partner Domains:

www.londonstockexchange.com
partner
loginservice.fxall.com
service
2025-07-17T15:50:15.331Z
exclaimer.com favicon

Exclaimer

exclaimer.com

58
TechnologyUnited KingdomlargeMEDIUM

Exclaimer is a well-established technology company founded in 1999, specializing in cloud-based email signature management software for Microsoft 365 and Google Workspace users. The company holds a strong market position, trusted by over 100,000 companies worldwide, and offers a SaaS subscription model with multiple pricing tiers. Their platform is recognized for its award-winning capabilities and centralized management of secure, consistent email signatures. Technically, the website is built on modern frameworks such as Next.js and React, hosted with Cloudflare DNS services, and optimized for performance and mobile responsiveness. The site demonstrates good SEO practices, accessibility, and a professional design that aligns with their brand identity. Consent management is implemented via OneTrust, reflecting a mature approach to privacy compliance. From a security perspective, the website enforces HTTPS, employs multiple security headers, and restricts domain transfer and updates, indicating a strong security posture. However, DNSSEC is not enabled, which is a recommended enhancement. No vulnerabilities or exposed sensitive data were detected. Privacy policies and cookie consent mechanisms are comprehensive and GDPR compliant. Overall, Exclaimer's website reflects a high level of professionalism, security, and compliance, supporting its credibility and trustworthiness in the technology sector. Strategic recommendations include enabling DNSSEC, publishing a dedicated security policy and incident response contacts, and considering a vulnerability disclosure program to further enhance transparency and security readiness.

-
100
17
77
-
85
100
ReactNext.jsCloudflare DNS
2025-07-17T15:48:45.036Z
themanufacturermxawards.com favicon

Hennik Research, part of Nineteen Group

themanufacturermxawards.com

60
ManufacturingUnited KingdommediumMEDIUM

The Manufacturer MX Awards website represents a well-established event platform focused on celebrating manufacturing excellence in the UK. Delivered by Hennik Research, part of the Nineteen Group, in partnership with The Manufacturer and the Institution of Mechanical Engineers, the site targets industrial businesses seeking recognition in innovation, sustainability, and leadership. The business model centers on event organization and industry awards, positioning itself as a gold standard with over 50 years of heritage. Technically, the website leverages a custom event management platform (Evessio) with modern JavaScript libraries, Google reCAPTCHA for bot protection, and hosting of static assets on Amazon S3. The site is moderately performant, mobile-optimized, and SEO-friendly, though accessibility features are basic. No major CMS is detected beyond the event platform. From a security perspective, HTTPS is enabled with CSRF tokens and bot protection via DataDome. However, DNSSEC is not enabled, and no explicit security headers are detected, which could be improved. Privacy compliance is basic with a privacy policy present but lacking cookie consent mechanisms and detailed GDPR indicators. Contact information is limited to a contact form without direct emails or phone numbers. Overall, the website is professional and trustworthy with a good business credibility score. Security posture and privacy compliance could be enhanced to meet higher standards. Recommendations include enabling DNSSEC, adding security headers, implementing cookie consent, and publishing security and incident response policies.

40
53
2
60
72
75
100
manufacturingawardsindustryeventuk+1 more
JavaScriptjQueryFontAwesomeGoogle reCAPTCHA+1

Partner Domains:

themanufacturer.com
partner
imeche.org
partner

+1 more partners

2025-07-17T15:47:44.802Z
installeronline.co.uk favicon

Installer Online

installeronline.co.uk

49
EnergyUnited KingdommediumHIGH

Installer Online is a UK-based digital media platform providing essential news, updates, and resources for professionals in the heating, plumbing, and renewable energy sectors. It serves as a key information hub for installers, offering industry news, event coverage, training information, and product updates. The site is part of the Nineteen Group, a known media company, which enhances its credibility and market position. The website targets heating and plumbing professionals, installers, and related stakeholders in the UK energy sector. Technically, the website is built on WordPress with a modern tech stack including Bootstrap, jQuery, and integrates multiple marketing and analytics tools such as Google Analytics, HubSpot, Facebook Pixel, and Parsely. The site is mobile-optimized and demonstrates good SEO practices. Performance is moderate, with room for improvement in accessibility and security headers. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms aligned with GDPR requirements. However, it lacks visible security headers and publicly available security policies or incident response information. The WHOIS data is unavailable due to a domain registration error from Nominet UK, which is unusual but the site appears legitimate and professionally maintained. Overall, Installer Online presents a professional and trustworthy digital presence with strong content quality and business credibility. Strategic improvements in security headers, incident response transparency, and WHOIS registration clarity would enhance its security posture and trustworthiness further.

15
83
2
70
72
65
-
energyplumbingheatingrenewablesinstaller+4 more
WordPress 6.8.2jQueryBootstrap 3.3.5Google Tag Manager+6

Partner Domains:

www.installershow.com
partner
www.nineteengroup.com
parent
2025-07-17T15:47:09.229Z
S

Spotler Ltd

cgtforms.com

56
TechnologyUnited KingdommediumMEDIUM

Spotler Ltd operates a marketing platform specializing in email marketing delivery and authentication services. The analyzed domain cgtforms.com is used by Spotler customers for email authentication and link redirection, serving as a technical domain rather than a direct customer-facing website. The website content is minimal but professional, providing transparency about data privacy and compliance with spam laws. The company positions itself as a trusted provider in the email marketing sector with a medium-sized business footprint in the UK. Technically, the website uses standard HTML and CSS with FontAwesome icons, hosted under a domain registered via Easyspace Limited. The site is mobile responsive with basic accessibility and SEO features but lacks advanced security headers and cookie consent mechanisms. DNSSEC is not enabled, representing a potential security enhancement. No tracking or analytics scripts were detected, indicating minimal user tracking. From a security perspective, the domain registration includes protective statuses to prevent unauthorized transfers or updates, enhancing trustworthiness. However, the absence of security headers and cookie policies suggests room for improvement in security posture and privacy compliance. No vulnerabilities or suspicious patterns were identified. Overall, the site is safe, professional, and compliant with GDPR principles, but could benefit from enhanced security and privacy features. The overall risk is low given the nature of the site as an informational domain for a marketing platform. Strategic recommendations include enabling DNSSEC, implementing security headers, adding cookie consent mechanisms, and publishing security and incident response policies to improve trust and compliance.

40
53
2
60
52
70
100
emailmarketingdataprivacyspotlermarketingplatformemailauthentication
HTML5CSS3FontAwesome 5.0.13
2025-07-17T15:43:38.269Z