Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157330
Websites
130
Industries
113
Countries
52
Avg Score
Page 828 of 1064|Showing 41351-41400 of 53176
diabetes.be favicon

Diabetes Liga

diabetes.be

56
HealthcareBelgiummediumMEDIUM

Diabetes Liga is a well-established non-profit organization based in Belgium focused on providing comprehensive information, support, and mobilization for people affected by diabetes. The website serves as a key resource for diabetes education, prevention programs, and community engagement, targeting patients, families, and healthcare professionals in the Flemish region. The organization maintains a strong market position as a trusted healthcare information provider with a professional digital presence. Technically, the website is built on Drupal 11, leveraging modern web technologies and Google Tag Manager for analytics and marketing. The site is mobile-optimized, accessible, and SEO-friendly, reflecting a mature digital infrastructure. Security measures include HTTPS enforcement and standard security headers, though there is room for improvement in publishing explicit security policies and incident response details. The security posture is solid with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms, aligning with GDPR requirements. However, the WHOIS data is restricted, which slightly impacts domain trustworthiness but is common for .be domains. Overall, the site presents a low-risk profile with strong business credibility and user trust. Strategic recommendations include enhancing transparency by publishing a security policy and incident response contacts, and considering a vulnerability disclosure policy to further strengthen security culture and stakeholder confidence.

40
83
2
75
72
70
20
healthcarediabetesnon-profiteducationmedical+2 more
Drupal 11Google Tag ManagerjQueryGoogle Fonts (Ubuntu)

Partner Domains:

shop.diabetes.be
partner
2025-07-07T05:35:17.491Z
indiegroup.be favicon

Indie Group

indiegroup.be

54
TechnologyBelgiummediumMEDIUM

Indie Group is a medium-sized digital agency based in Belgium specializing in digital strategy, development, and performance marketing. They leverage a team of over 50 experts to deliver tailored digital solutions focused on measurable business growth. The company holds strong partnerships with leading technology providers such as HubSpot, Google, TikTok, and Meta, positioning itself as a trusted HubSpot Gold Partner and technology integrator. Their service offerings include performance marketing, e-commerce development, analytics, and conversion optimization, targeting businesses seeking to enhance their digital presence and marketing effectiveness. Technically, the website is built on modern web technologies including Craft CMS, JavaScript frameworks, and integrates multiple tracking and marketing tools such as Google Tag Manager, Facebook Pixel, and LinkedIn Insight Tag. The site is well optimized for performance, mobile responsiveness, and SEO, reflecting a mature digital infrastructure. Security practices include HTTPS enforcement and use of reCAPTCHA v3 on forms, though there is room for improvement in publishing explicit security policies and headers. From a security perspective, the website demonstrates good baseline protections with encrypted connections and consent mechanisms for cookies, but lacks publicly available incident response or vulnerability disclosure information. The WHOIS data is restricted by the registry, which is common and justified for privacy reasons in this business context. Overall, the site presents a professional and trustworthy digital presence with no critical vulnerabilities detected. Strategically, Indie Group should consider enhancing transparency around security policies and incident response to further build trust with clients. Regular audits of third-party scripts and implementation of security headers would strengthen their security posture. Maintaining compliance with GDPR and evolving regulations will be essential as they continue to grow their digital marketing and technology services.

15
10
2
65
95
60
100
digitalagencyperformancemarketingtechnologysolutionshubspotpartnere-commerce+3 more
JavaScriptGoogle Tag ManagerFacebook PixelLinkedIn Insight Tag+5

Partner Domains:

hubspot.com
partner
google.com
partner

+3 more partners

2025-07-07T05:35:12.484Z
F

Federal Reserve Bank of St. Louis

stlouisfed.org

53
GovernmentUnited StateslargeMEDIUM

The Federal Reserve Bank of St. Louis operates as one of the 12 regional Reserve Banks within the Federal Reserve System, serving a critical role in the U.S. central banking framework. The website provides extensive economic resources, data tools, research publications, and educational materials targeted at economists, financial institutions, educators, and the general public. It maintains a strong market position as an authoritative source for economic data and Federal Reserve information. Technically, the website employs a modern technology stack including Bootstrap 4, jQuery, Google Tag Manager, and analytics tools such as Google Analytics and Crazy Egg. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate with room for optimization. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes several security best practices. While some security headers are not explicitly detected, the overall posture is strong with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms and GDPR compliance. Overall, the website is highly professional, trustworthy, and aligned with the Federal Reserve's mission. The lack of WHOIS data is mitigated by the authoritative content and branding. The site poses low risk and serves as a reliable resource for its audience.

-
58
25
70
-
85
100
federalreserveeconomicdatabankingresearcheducation+1 more
jQuery 3.7.1Bootstrap 4Google Tag ManagerGoogle Analytics+3

Partner Domains:

fred.stlouisfed.org
partner
fraser.stlouisfed.org
partner

+2 more partners

2025-07-07T05:34:17.366Z
biv.be favicon

Beroepsinstituut van Vastgoedmakelaars

biv.be

65
Real EstateBelgiummediumMEDIUM

The Beroepsinstituut van Vastgoedmakelaars (BIV) is the official professional institute and regulatory body for real estate brokers in Belgium. It focuses on ensuring integrity, professionalism, and compliance within the real estate sector by providing certification, training, complaint handling, and knowledge dissemination. The website serves as a comprehensive resource for brokers, trainees, and the public, offering detailed information on becoming a broker, ethical guidelines, and complaint procedures. The organization maintains a strong market position as the authoritative entity overseeing real estate professionals in Belgium. Technically, the website is built on Drupal 10, leveraging modern web technologies and integrating Google Tag Manager and Cookiebot for analytics and privacy compliance. The site is well-optimized for mobile devices, accessible, and SEO-friendly, with a professional design and clear navigation. Privacy and cookie policies are prominently available, demonstrating good compliance with GDPR requirements. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms. However, no advanced security headers or explicit security policies were detected, and no vulnerability disclosure or incident response contacts are published. The WHOIS data for the domain is restricted, limiting transparency about domain ownership, which slightly impacts trust but is common for .be domains. Overall, the website presents a professional, trustworthy, and well-maintained digital presence for the BIV, with minor recommendations to enhance security posture and transparency to further strengthen trust and compliance.

55
83
2
65
52
80
100
realestateregulatoryprofessionalinstitutebelgiumbiv+5 more
Drupal 10Google Tag ManagerCookiebotjQuery UI Autocomplete

Partner Domains:

ipi.be
partner
2025-07-07T05:33:52.322Z
lexology.com favicon

Law Business Research

lexology.com

70
MediaN/alargeMEDIUM

Lexology is a leading global platform delivering comprehensive international legal updates, analysis, and insights primarily targeted at law firms and in-house counsel. The platform offers a wide range of services including legal newsfeeds, research hubs, compliance calendars, masterclasses, and analytics tools, positioning itself as a key resource in the legal media sector. The website is professionally designed with consistent branding and good content quality, supporting its market position as a trusted legal intelligence provider. Technically, Lexology employs modern web technologies such as React, Google Analytics, Hotjar, and CookiePro for tracking and consent management, ensuring a mature digital infrastructure. Security posture is strong with HTTPS enforcement and standard security headers, although explicit security policies and incident response contacts are not publicly disclosed. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The absence of WHOIS data limits full verification of domain legitimacy, but the overall professional presentation and trust signals support a positive risk assessment. Strategic recommendations include publishing security policies, incident response contacts, and enhancing accessibility to further strengthen trust and compliance.

40
95
2
85
75
85
100
legalnewsmediacomplianceanalytics+3 more
ReactjQueryFontAwesomeGoogle Analytics+5
2025-07-07T05:33:47.313Z
bartlit-beck.com favicon

Bartlit Beck LLP

bartlit-beck.com

59
OtherUnited StatesmediumMEDIUM

Bartlit Beck LLP is a nationally recognized boutique law firm specializing in trial practice and corporate transactions. The firm targets corporate clients and individuals requiring high-stakes litigation and corporate legal services. Their business model emphasizes success-based fee arrangements and delivering exceptional client outcomes, supported by numerous industry awards and client testimonials. The website reflects a professional and consistent brand image with comprehensive content tailored to their target audience. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, with custom CSS and JavaScript for user experience enhancements. The site is mobile optimized, accessible, and SEO-friendly, though no CMS or hosting provider details are explicitly identified. Performance is moderate, with good navigation and content structure. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers and formal security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is notably missing or inaccessible, which raises some concerns about domain registration transparency, though the website content and professional presentation strongly indicate legitimacy. Overall, the site scores well on content quality, business credibility, and technical implementation, with room for improvement in security policy transparency and WHOIS data availability.

40
53
2
65
62
70
100
lawfirmlegalservicestrialpracticecorporatetransactionsprofessionalservices
Google AnalyticsGoogle Tag ManagerjQuery (implied by cycle plugin usage)Custom CSS and JS
2025-07-07T05:33:22.269Z
hirschlerlaw.com favicon

Hirschler Fleischer

hirschlerlaw.com

64
Real EstateUnited StatesmediumMEDIUM

Hirschler Fleischer is a professional law firm based in Virginia, providing a broad range of legal services with a focus on client success and complex legal issues. The firm positions itself as a national-caliber entity with a strong emphasis on partner involvement and business efficiency. Their website reflects a medium-sized firm with consistent branding and professional content aimed at business and individual clients seeking legal counsel. Technically, the website employs modern web standards including HTTPS, Google Tag Manager for analytics, and responsive design elements. While the site performs moderately well and offers good accessibility and SEO features, there is room for improvement in security headers and cookie consent mechanisms to enhance privacy compliance. From a security perspective, the site benefits from HTTPS and secure form practices but lacks visible security headers and a formal vulnerability disclosure policy. The absence of WHOIS data raises questions about domain registration legitimacy, although the professional presentation and external references support the firm's credibility. Overall, the site is safe, trustworthy, and suitable for general audiences. Strategically, the firm should address privacy compliance gaps, enhance security headers, and clarify domain registration details to strengthen trust and security posture.

40
53
17
70
72
80
100
lawfirmlegalservicesvirginiaprofessionalservicesbusinesslaw+1 more
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:33:17.250Z
wiley.law favicon

Wiley Rein LLP

wiley.law

69
GovernmentUnited StateslargeMEDIUM

Wiley Rein LLP is a prominent law firm based in Washington, DC, specializing in a broad range of legal fields including Election Law, Environment, Government Contracts, Insurance, Intellectual Property, International Trade, Litigation, Telecom, and White Collar Defense. The firm boasts a large team of 260 attorneys and maintains a strong market position as a leading legal service provider with deep government connections. Their business model focuses on delivering specialized legal and regulatory advice to corporate and government clients. The website reflects a professional and authoritative presence consistent with their market stature. Technically, the website employs modern analytics and tracking technologies such as Google Analytics, Google Tag Manager, Hotjar, and Siteimprove Analytics, combined with a responsive design and good accessibility features. The site is well-structured with clear navigation and optimized for SEO, providing a positive user experience. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms aligned with GDPR compliance. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. No vulnerabilities or exposed sensitive data were found in the HTML content. The WHOIS data is unavailable, likely due to privacy protection, which is justified for a law firm. Overall, the security posture is solid but could be enhanced with additional headers and transparency. The overall risk assessment is low, with the website demonstrating high professionalism, trustworthiness, and compliance. Strategic recommendations include implementing security headers, publishing a security policy, and establishing a vulnerability disclosure process to further strengthen security and trust.

70
68
17
80
52
80
100
lawfirmlegalserviceswashingtondcgovernmentcontractsintellectualproperty+4 more
Google Tag ManagerGoogle AnalyticsHotjarSiteimprove Analytics+1
2025-07-07T05:33:07.224Z
sheppardmullin.com favicon

Sheppard Mullin

sheppardmullin.com

74
OtherUnited StateslargeMEDIUM

Sheppard Mullin is a prominent AmLaw 100 law firm with a broad international presence across the United States, Europe, and Asia. The firm offers a comprehensive range of legal services spanning numerous practice areas including corporate law, litigation, intellectual property, privacy and cybersecurity, and more. Their website reflects a mature digital presence with professional branding, clear navigation, and extensive content tailored to corporate clients and legal professionals. The firm positions itself as a leader in the legal industry with recognized awards and a strong market reputation. From a technical perspective, the website employs modern web technologies including Google Tag Manager, Adobe DTM, and various analytics and marketing pixels. The site is mobile-optimized and includes accessibility features such as the UserWay widget, indicating a commitment to compliance and user inclusivity. Performance is moderate with good SEO and accessibility standards met. Security-wise, the site enforces HTTPS and uses several best practices, though it lacks explicit security headers and a public security policy or vulnerability disclosure page. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong with clear privacy and cookie policies and consent mechanisms in place. Overall, the website presents a low risk profile with a high degree of professionalism and trustworthiness. The absence of WHOIS data is a notable anomaly but does not detract significantly from the site's legitimacy given the comprehensive and consistent business information presented. Strategic recommendations include enhancing security headers, publishing a security policy, and adding a vulnerability disclosure mechanism to further strengthen trust and security posture.

70
68
47
70
67
85
100
lawfirmlegalservicesamlaw100privacypolicycookiepolicy+2 more
JavaScriptGoogle Tag ManagerSiteimprove AnalyticsLinkedIn Insight Tag+3
2025-07-07T05:32:42.180Z
schwabe.com favicon

Schwabe

schwabe.com

63
OtherUnited StateslargeMEDIUM

Schwabe is a well-established regional law firm with over 130 years of history, focusing on providing tailored legal services across various industries in the Northwest United States. Their website reflects a professional and comprehensive presentation of their services, emphasizing industry-specific expertise and client commitment. The firm targets businesses and legal professionals seeking specialized counsel in sectors such as manufacturing, healthcare, natural resources, maritime, real estate, and technology. The business model centers on delivering legal solutions aligned with regional and industry needs, positioning Schwabe as a trusted legal partner in their market. Technically, the website is built on WordPress and incorporates modern web technologies including Google Fonts, Google Tag Manager, and New Relic for performance monitoring. The site is mobile-optimized, accessible, and SEO-friendly, with a fast to moderate performance profile. Security measures include HTTPS enforcement, use of Google reCAPTCHA on forms, and a cookie consent mechanism, indicating a mature digital infrastructure. From a security perspective, the site demonstrates good practices such as encrypted connections and bot protection. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. The absence of WHOIS data reduces transparency but does not detract significantly from the site's legitimacy given the professional presentation and consistent branding. Overall, Schwabe's website presents a low-risk profile with strong business credibility and a solid technical foundation. Strategic recommendations include enhancing security headers, publishing security policies, and improving WHOIS transparency to further strengthen trust and compliance.

25
53
2
70
95
80
100
lawfirmlegalservicesprofessionalservicesregionalbusinessindustryfocused
WordPressGoogle FontsGoogle Tag ManagerGoogle reCAPTCHA+2
2025-07-07T05:32:32.166Z
M

Mitchell Silberberg & Knupp LLP

msk.com

56
MediaUnited StateslargeMEDIUM

Mitchell Silberberg & Knupp LLP is a well-established full-service law firm with deep roots in the Los Angeles entertainment industry since 1908. The firm has expanded nationally with offices in Los Angeles, New York, and Washington, D.C., offering a broad range of legal services including intellectual property, litigation, labor and employment, corporate law, immigration, regulatory, tax, and trusts & estates. The website reflects a professional and stable firm culture with a focus on creative legal advisory and business partnership. Technically, the website employs modern web technologies such as HTML5 video, JWPlayer, and integrates Google Analytics and Tag Manager for tracking. The site is moderately optimized for performance and mobile use, with good SEO practices evident in meta tags and structured content. Security posture is adequate with HTTPS implied, but lacks visible security headers and explicit privacy or cookie policies, which are areas for improvement. The absence of WHOIS data raises some concerns about domain registration transparency, though the website content and branding strongly support legitimacy. Overall, the site is professional and trustworthy but would benefit from enhanced privacy compliance and security best practices.

40
35
17
60
42
75
100
lawfirmlegalservicesentertainmentindustryintellectualpropertylitigation+3 more
jwplayer 7.0.0Google Tag ManagerGoogle AnalyticsHTML5 video+2
2025-07-07T05:32:27.159Z
wwhgd.com favicon

Weinberg Wheeler

wwhgd.com

67
OtherUnited StatesmediumMEDIUM

Weinberg, Wheeler, Hudgins, Gunn & Dial, LLC is a national litigation law firm specializing in complex, high-exposure cases, particularly in construction law and catastrophic legal disputes. The firm positions itself as a bold and innovative advocate with extensive trial and arbitration experience across multiple states. Their website reflects a professional and polished digital presence, targeting corporate clients, insurance carriers, and legal professionals seeking expert litigation services. The firm emphasizes its strategic approach and proven track record through client testimonials and detailed service descriptions. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, WebP images for optimized media delivery, and HTML5 video content. The site is mobile-optimized with good accessibility and SEO practices. However, no CMS or hosting provider details are explicitly identified. Performance is moderate with room for improvement in security header implementation. From a security perspective, the site uses HTTPS and has a cookie consent mechanism aligned with privacy regulations, including GDPR compliance. However, no explicit security policies or incident response contacts are published, and security headers are not detected, which could be improved to enhance protection and trust. The absence of WHOIS data for the domain is a notable concern, as it reduces transparency and trustworthiness from a domain registration standpoint. Overall, the website is professional and trustworthy in content and design but would benefit from improved domain registration transparency and enhanced security practices to strengthen its risk posture and compliance stance.

55
68
17
70
72
80
100
lawfirmlitigationconstructionlawtrialadvocacylegalservices+3 more
Google AnalyticsGoogle Tag ManagerSlick CarouselCustom JavaScript+2
2025-07-07T05:32:22.151Z
irell.com favicon

Irell & Manella LLP

irell.com

64
OtherUnited StatesmediumMEDIUM

Irell & Manella LLP is a reputable law firm specializing in high-stakes business litigation, including patent litigation, securities fraud defense, and complex contract disputes. The firm is recognized for achieving exceptional client outcomes and holds ISO 27001 certification, underscoring its commitment to information security. The website presents a professional and well-structured digital presence targeting corporate clients and legal professionals. Technically, the website employs modern web technologies including Google Tag Manager for analytics and tracking, with good mobile optimization and accessibility features. The site uses HTTPS with an excellent SSL configuration, though security headers are not explicitly detected. Privacy compliance is strong with a comprehensive privacy policy and cookie consent mechanism. Security posture is solid, supported by ISO 27001 certification and secure website practices, but could be improved by adding visible security headers and publishing incident response or vulnerability disclosure information. The absence of WHOIS data is unusual but does not detract significantly from the site's legitimacy given the professional content and trust signals. Overall, the website is trustworthy, professional, and secure with minor areas for improvement in security transparency and contact information visibility.

40
53
17
65
72
80
100
lawfirmbusinesslitigationpatentlitigationiso27001legalservices
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:32:17.143Z
aalrr.com favicon

Atkinson, Andelson, Loya, Ruud & Romo

aalrr.com

68
OtherUnited StateslargeMEDIUM

Atkinson, Andelson, Loya, Ruud & Romo is a well-established California-based law firm with over 40 years of experience and a large team of over 200 attorneys across nine offices. The firm offers a broad range of legal services including labor and employment law, corporate finance, education law, litigation, and public safety, targeting both public and private sector clients. Their market position is strong within California, supported by awards, client testimonials, and recognized diversity initiatives. Technically, the website employs modern web technologies such as jwplayer for media, Google Analytics and Tag Manager for tracking, and HubSpot for marketing and analytics. The site is well-structured, mobile-optimized, and accessible, with good SEO practices and a comprehensive cookie consent mechanism. However, no CMS or hosting provider details were explicitly identified. From a security perspective, the site enforces HTTPS and provides cookie consent management, but lacks explicit security headers and a published security policy or incident response contacts. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS domain registration data is a notable concern, potentially indicating privacy protection or a registration anomaly, which slightly impacts trustworthiness. Overall, the website is professional, trustworthy, and compliant with privacy regulations, but would benefit from enhanced transparency in domain registration and explicit security policies to improve its security posture and business credibility.

40
83
17
80
62
80
100
legallawfirmcaliforniaattorneysprivacy+4 more
jwplayerGoogle AnalyticsGoogle Tag ManagerHubSpot+2
2025-07-07T05:32:12.136Z
calfee.com favicon

Calfee, Halter & Griswold LLP

calfee.com

73
OtherUnited StateslargeMEDIUM

Calfee, Halter & Griswold LLP is a well-established full-service corporate law firm with over 120 years of experience, serving clients primarily in the Midwest United States but also nationally and globally through its partnership with Lex Mundi. The firm offers a broad range of legal services including corporate and finance, litigation, intellectual property, government relations, and various business support practices. The website reflects a mature and professional organization with strong market positioning and client trust evidenced by industry rankings and testimonials. Technically, the website employs modern web technologies such as jwplayer for media, Google Tag Manager, and LinkedIn Insight for analytics and marketing. The site is well-structured, mobile-optimized, and demonstrates good SEO and accessibility practices. Privacy and cookie policies are clearly presented with consent mechanisms, indicating compliance with GDPR and other privacy regulations. From a security perspective, the site uses HTTPS and secure forms, but lacks explicit security headers and a published security.txt file. No critical vulnerabilities or exposed sensitive data were detected. The WHOIS data is not publicly available, which slightly reduces transparency but is not uncommon for professional services firms. Overall, the website presents a low-risk profile with strong business credibility and good security hygiene. Strategic improvements in security header implementation and incident response transparency would further enhance trust and resilience.

40
68
47
85
72
85
100
lawfirmcorporatelawintellectualpropertylitigationgovernmentrelations+4 more
jwplayerGoogle Tag ManagerLinkedIn Insight TagTypekit Fonts

Partner Domains:

connect.calfee.com
service
www.linkedin.com
partner

+3 more partners

2025-07-07T05:32:07.128Z
stinson.com favicon

Stinson LLP

stinson.com

68
OtherUnited StateslargeMEDIUM

Stinson LLP is a well-established law firm providing a broad range of legal services to individuals, privately held enterprises, national companies, and international public corporations. The firm emphasizes practical legal guidance, risk minimization, and opportunity realization, supported by a collaborative culture and extensive legal knowledge. Their market position is strong, with multiple office locations across the United States and recognition in legal rankings such as Chambers USA. The website reflects a professional and trustworthy brand with clear navigation and comprehensive content. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, uses web fonts for branding consistency, and implements HTTPS with good security practices. The site is mobile optimized and accessible, with cookie consent mechanisms in place indicating GDPR compliance awareness. However, some advanced security headers are missing, and no explicit security policy or incident response contact information is published. From a security perspective, the site demonstrates a solid posture with HTTPS enforced and secure form handling. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data is notable but does not detract significantly from the site's legitimacy given the professional content and external trust signals. Overall, the site scores well on content quality, technical implementation, security, privacy compliance, and business credibility, making it a reliable and professional online presence for Stinson LLP.

55
68
17
65
72
85
100
lawfirmlegalservicesattorneysprofessionalservicesprivacypolicy+2 more
Google AnalyticsGoogle Tag ManagerWeb fonts (Brandon Grotesque, Freight Text Pro)JavaScript+2

Partner Domains:

paytrace.com
partner
firmseek.com
partner
2025-07-07T05:32:02.121Z
baileyglasser.com favicon

Bailey & Glasser, LLP

baileyglasser.com

64
OtherUnited StatesmediumMEDIUM

Bailey & Glasser, LLP is a nationally recognized law firm specializing in high-stakes litigation and corporate law. The firm serves a diverse clientele including corporations, government entities, individuals, and consumer classes, offering a broad range of legal services such as business litigation, personal injury, class actions, and appellate advocacy. The firm holds a strong market position supported by multiple prestigious awards and rankings, reflecting its expertise and reputation in the legal industry. Technically, the website demonstrates a mature digital infrastructure with modern tracking and analytics tools, good mobile optimization, and a professional design that supports user engagement and trust. Security posture is solid with HTTPS enforcement and secure form practices, although there is room for improvement in implementing comprehensive security headers and publishing explicit security policies. Privacy compliance is well addressed with clear cookie consent mechanisms and a comprehensive privacy policy. Overall, the website and business present a high level of professionalism and trustworthiness, though the absence of WHOIS data limits domain registration transparency. Strategic recommendations include enhancing security header implementation, publishing incident response information, and considering a vulnerability disclosure policy to further strengthen security and trust.

40
68
17
70
52
80
100
lawfirmlitigationcorporatelawlegalservicesclassactions+3 more
Google Tag ManagerGoogle Analytics (gtag.js)HotjarFacebook Pixel+3

Partner Domains:

thebaileyglasserblog.com
partner
www.firmseek.com
partner
2025-07-07T05:31:52.100Z
porterhedges.com favicon

Porter Hedges LLP

porterhedges.com

66
OtherUnited StateslargeMEDIUM

Porter Hedges LLP is a well-established law firm specializing in sophisticated transactions and complex litigation across multiple industries including energy, real estate, finance, and corporate law. The firm is recognized for its depth of experience and ability to meet client business objectives, holding a strong market position particularly in Texas. The website reflects a professional and comprehensive presentation of their services, targeting public and private companies seeking legal expertise. Technically, the website employs modern web technologies such as jwplayer for multimedia, Google Tag Manager for analytics, and Typekit for fonts. The site is well-structured, mobile-optimized, and accessible, with good SEO practices. However, some improvements could be made in security headers and privacy compliance mechanisms. Security posture is solid with HTTPS enforced and secure form handling, but lacks explicit security headers and published security policies or incident response contacts. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data reduces domain trust slightly but the professional content and external recognitions support legitimacy. Overall, the website is a strong digital asset for Porter Hedges LLP, though enhancing privacy compliance and security transparency would further strengthen trust and compliance posture.

40
53
2
70
95
85
100
lawfirmlegalservicesbankruptcycorporatelawenergylaw+2 more
jwplayerGoogle Tag ManagerTypekit FontsJavaScript+1
2025-07-07T05:31:47.092Z
mmlk.com favicon

McBrayer PLLC

mmlk.com

67
OtherUnited StatesmediumMEDIUM

McBrayer PLLC is a well-established law firm serving the Kentucky business community since 1963. The firm offers a broad range of legal services including corporate law, real estate, healthcare, intellectual property, and employment law. It maintains a strong regional presence with offices in Lexington, Louisville, and Frankfort, and is affiliated with global legal networks such as Meritas and SCG Legal, enhancing its market position and service capabilities. The website reflects a professional and trustworthy brand with comprehensive content and clear navigation aimed at business clients and professionals in the region. Technically, the website employs modern web technologies including Google Tag Manager, Facebook Pixel, LinkedIn Insight Tag, and jwplayer for media content. The site is served over HTTPS with no visible security vulnerabilities in the HTML content. However, there is room for improvement in privacy compliance, particularly the absence of a cookie consent banner and security headers. Mobile optimization and accessibility are basic but functional, supporting a moderate user experience. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and use of secure analytics scripts. The lack of WHOIS data for the domain is a concern, as it reduces transparency and trustworthiness. No security policy or incident response information is published, which could be enhanced to improve security posture and client confidence. Overall, the site is secure and professional but could benefit from enhanced privacy and security disclosures. The overall risk assessment is moderate with a high level of business credibility but some technical and compliance gaps. Strategic recommendations include implementing a cookie consent mechanism, adding security headers, publishing a security policy, and verifying domain registration details to strengthen trust and compliance.

45
58
17
85
62
85
100
lawfirmlegaladvicekentuckylitigationcorporatelaw+4 more
jwplayerGoogle Tag ManagerGoogle Analytics (gtag.js)Facebook Pixel+2

Partner Domains:

www.mmlkgov.com
partner
www.meritas.org
partner

+1 more partners

2025-07-07T05:31:22.008Z
aijobs.app favicon

Startup Jobs

aijobs.app

65
TechnologyN/amediumMEDIUM

AIJobs.app is a specialized job board platform focusing on artificial intelligence roles across various functions including development, design, marketing, and sales. It serves as a marketplace connecting job seekers with fast-growing AI startups, offering over 100,000 job listings. The platform leverages modern web technologies such as Ruby on Rails, Hotwired Turbo, StimulusJS, and Algolia for search, ensuring a responsive and user-friendly experience. The site is well-branded and professionally designed, targeting both employers and candidates in the AI startup ecosystem. From a technical perspective, the website demonstrates a mature digital infrastructure with good mobile optimization and SEO practices. It uses HTTPS with CSRF protections on forms, but lacks some security headers and explicit security policies. The absence of privacy and cookie policies indicates partial privacy compliance, which could be improved to meet GDPR and other regulations fully. Contact information is limited to a support email and contact forms, with no phone numbers or physical addresses disclosed. Security posture is moderate, with secure form handling and HTTPS but missing explicit security policies and vulnerability disclosures. No critical vulnerabilities or suspicious content were detected. The domain uses privacy protection for WHOIS data, which is common and justified for this business type. Overall, the site appears legitimate and trustworthy but would benefit from enhanced transparency and compliance documentation. Strategic recommendations include publishing comprehensive privacy and cookie policies, implementing security headers, and providing incident response contacts to improve trust and compliance. Enhancing accessibility and performance monitoring could further strengthen the platform's technical robustness.

65
35
2
95
75
70
100
aijobsartificialintelligencejobboardtechnologystartups+1 more
Ruby on RailsHotwired TurboStimulusJSTailwind CSS+3

Partner Domains:

startup.jobs
partner
web3.career
partner
2025-07-07T05:30:56.751Z
soscarbon.com favicon

SOS Carbon

soscarbon.com

64
EnergyPhilippinessmallMEDIUM

SOS Carbon is a small, innovative company focused on providing cost-effective and responsible solutions for the collection, disposal, and transformation of sargassum seaweed, supporting sustainable tourism and the blue economy. The company leverages patented technology and academic roots from MIT to position itself as a leader in marine environmental management. Their services include device manufacturing, technology licensing, consulting, and carbon credit facilitation, targeting coastal communities and tourism stakeholders. The website reflects a professional and consistent brand with clear messaging and multimedia content to engage visitors. Technically, the website is built using GoDaddy Website Builder hosted on GoDaddy infrastructure, employing modern web technologies including JavaScript frameworks and Google Analytics for user tracking. The site is mobile-optimized with good SEO practices but lacks some advanced accessibility features. Performance is moderate with room for improvement. From a security perspective, the site uses HTTPS and registers a service worker, but lacks DNSSEC and security headers, and does not publish a security policy or incident response contacts. Privacy compliance is partial, with a cookie consent banner but no privacy policy or terms of service pages. The domain registration is consistent and transparent, supporting the legitimacy of the business. Overall, SOS Carbon presents a trustworthy and professional online presence with some gaps in privacy and security documentation. Addressing these gaps would enhance compliance and user trust.

45
50
25
60
77
80
100
environmentsargassumseaweedsustainabilityblueeconomy+4 more
JavaScriptReact (implied by React commonjs external)Google Tag ManagerService Worker+1
2025-07-07T05:30:01.648Z
P

Puro.earth Oy

puro.earth

60
EnergyFinlandmediumMEDIUM

Puro.earth Oy operates a leading carbon removal certification platform focused on mobilizing the net-negative economy by certifying carbon removal suppliers and issuing CO2 Removal Certificates (CORCs). The company serves corporate buyers and partners globally, providing a trusted standard and registry for engineered carbon removal. Their business model centers on facilitating transparent and verifiable carbon removal transactions, supported by a robust supplier and buyer network. The website reflects a mature digital presence with clear branding, comprehensive content, and strong market positioning in the energy and sustainability sector. Technically, the site leverages the Odoo CMS platform, integrates multiple analytics and marketing tools including Google Analytics, HubSpot, and Facebook Pixel, and is hosted on Azure DNS infrastructure. The site is mobile-optimized and SEO-friendly, providing a professional user experience. Security posture is solid with HTTPS enforced and domain transfer protections in place, though DNSSEC is not enabled and some security headers are missing. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. No critical vulnerabilities or suspicious content were detected. Overall, Puro.earth demonstrates a credible, professional, and secure online presence aligned with its business objectives.

15
83
2
75
42
75
100
carbonremovalcarboncreditsenvironmentsustainabilityclimate+3 more
Odoo CMSGoogle AnalyticsGoogle Tag ManagerHubSpot Forms and Analytics+2
2025-07-07T05:29:21.572Z