Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 8 of 162|Showing 351-400 of 8072
xperience-group.com favicon

Xperience

xperience-group.com

73
TechnologyUnited KingdommediumMEDIUM

Xperience is a UK-based technology company specializing in delivering business efficiency through digital transformation solutions including Cyber Security, Cloud & IT Services, ERP, CRM, and AI. The company positions itself as a trusted partner for businesses seeking tailored digital solutions to improve productivity and security. Their website reflects a mature and professional digital presence with comprehensive service offerings and strong partnership ties, notably with Microsoft and other technology providers. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and utilizes various JavaScript libraries for enhanced user experience. SEO and accessibility are well addressed, and the site is mobile-optimized. The presence of security headers, HTTPS, and an Information Security Policy indicates a solid security posture. However, the lack of publicly available WHOIS data introduces some uncertainty about domain registration details. Security-wise, the site demonstrates good practices including HTTPS enforcement, security headers, and compliance with privacy regulations such as GDPR. Certifications like Cyber Essentials Plus further reinforce their commitment to security. No critical vulnerabilities or exposed sensitive data were detected. The site uses standard analytics and marketing tools with moderate user tracking. Overall, the website is trustworthy, professional, and well-maintained, supporting the company's credibility. The main risk factor is the absence of WHOIS transparency, which should be monitored. Strategic recommendations include publishing a vulnerability disclosure policy and incident response contacts to enhance transparency and trust.

83
70
100
54
55
88
55
cybersecurityclouditserviceserpcrmdigitaltransformation+3 more
WordPressYoast SEOBootstrapSlick Carousel+6

Partner Domains:

microsoft.com
partner
sage.com
partner

+2 more partners

2026-07-07T07:03:45.431Z
ifpl.com favicon

IFPL

ifpl.com

59
ManufacturingUnited KingdommediumMEDIUM

IFPL is a well-established UK-based electronics manufacturer specializing in audio, power, and interface solutions for aircraft cabin interiors. With over 25 years of experience and a strong market presence, IFPL serves leading IFEC manufacturers, OEMs, and airlines worldwide. The company emphasizes reliability and innovation, shipping over 3.5 million units globally. Their website reflects a professional B2B business model with clear branding and comprehensive product portfolios. Technically, the website is built on WordPress with Elementor and integrates modern analytics and marketing tools such as Google Analytics, HubSpot, Microsoft Clarity, and LinkedIn Insight. The site is mobile-optimized, accessible, and SEO-friendly, demonstrating digital maturity. Hosting and domain registration are consistent with the company's history, although DNSSEC is not enabled. From a security perspective, the site uses HTTPS with good SSL configuration and cookie consent mechanisms compliant with GDPR. However, some security headers are not explicitly detected, and no security.txt or incident response contacts are published. No vulnerabilities or exposed sensitive data were found in the HTML content. Overall, IFPL's website presents a low-risk profile with strong business credibility and good privacy compliance. Strategic improvements could include enabling DNSSEC, enhancing security headers, and publishing a vulnerability disclosure policy to further strengthen trust and security posture.

70
62
75
100
15
2
65
aircraftelectronicsmanufacturingaudiosolutionspowermodulesinterfacesolutions+3 more
WordPressElementorYoast SEOGoogle Tag Manager+4
2026-07-06T07:26:50.324Z
conceptnorthern.co.uk favicon

Concept Northern: The Assistive Technology Specialists

conceptnorthern.co.uk

68
HealthcareUnited KingdomsmallMEDIUM

Concept Northern is a specialized service provider in assistive technology based in Scotland, focusing on support for students and individuals in workplace environments. The company offers a range of services including DSA support, disability support, workplace support, needs assessments, and training/coaching. It is positioned as a leading assistive technology specialist in its region and operates under the parent company Optima Health Group, indicating a stable and credible business foundation. The website reflects a professional and consistent brand image with clear navigation and relevant content tailored to its target audience. Technically, the site is built on WordPress using Elementor and Yoast SEO, with Google Analytics integrated for performance tracking. The site is mobile optimized and demonstrates good SEO practices, although accessibility features are basic. Security posture is adequate with HTTPS enabled and no visible vulnerabilities, but lacks advanced security headers and formal security policies. Privacy compliance is a notable gap, with no privacy or cookie policies detected, which should be addressed to meet GDPR requirements. Overall, the website and business present a trustworthy and professional front with room for improvement in privacy and security transparency.

69
75
65
100
53
80
17
assistivetechnologydisabilitysupportdsasupportworkplacesupporttraining+2 more
WordPressElementorYoast SEOGoogle Analytics+1

Partner Domains:

assistiveit.co.uk
partner
pamgroup.co.uk
partner

+1 more partners

2026-07-06T07:23:34.658Z
yps.co.uk favicon

Yorkshire Packaging Systems

yps.co.uk

62
ManufacturingUnited KingdommediumMEDIUM

Yorkshire Packaging Systems (YPS) is a well-established UK-based company specializing in packaging machinery and materials, with over 45 years of industry experience. Their website showcases a broad range of packaging machinery including shrink wrapping, bagging, stretch wrapping, and vacuum packaging machines, targeting businesses requiring industrial packaging solutions. The company positions itself as a leader in the packaging sector with a focus on quality and service. Technically, the website is built on WordPress using Elementor and several plugins such as Gravity Forms and JetMenu, integrating Google Analytics and Zoho SalesIQ for analytics and customer engagement. The site is mobile-optimized and SEO-friendly, providing a good user experience. Security-wise, the site uses HTTPS and a cookie consent mechanism but lacks visible security headers and published security policies, which are areas for improvement. The WHOIS data for the domain is incomplete and inconsistent, which raises some concerns about domain registration transparency but does not directly impact the legitimacy of the business as presented on the website. Overall, the site is professional and trustworthy but would benefit from enhanced security disclosures and privacy documentation.

37
80
70
100
15
88
25
packagingmachinerypackagingmaterialsshrinkwrappingbaggingmachines+3 more
WordPressElementorGravity FormsJetMenu+4
2026-07-05T07:19:55.500Z
wbklaw.com favicon

Wilkinson Barker Knauer, LLP

wbklaw.com

62
OtherUnited StatesmediumMEDIUM

Wilkinson Barker Knauer, LLP is a medium-sized law firm specializing in telecommunications, media, energy, transportation, and related regulatory and transactional legal services. The firm operates multiple offices in key U.S. cities and positions itself as a top-tier provider combining large firm expertise with personalized client service. The website reflects a professional and client-focused business model targeting corporate and regulatory clients in specialized sectors. Technically, the website is built on WordPress using modern frameworks such as Foundation and jQuery, with SEO optimization via Yoast. The site is mobile-optimized and performs moderately well, though accessibility features could be enhanced. Security posture is strong with HTTPS enforced, but lacks some security headers and cookie consent mechanisms, which are recommended for compliance and protection. The WHOIS data is notably missing or inaccessible, which raises some concerns about domain registration transparency. However, the website's professional content, external trust signals, and clear contact information support its legitimacy. No signs of malicious activity or adult content were detected, making the site safe for general audiences. Overall, the firm demonstrates a solid digital presence with room for improvement in privacy compliance and security best practices to enhance trust and regulatory adherence.

15
65
47
80
27
80
100
lawfirmtelecommunicationsenergylegalservicesprivacy+3 more
jQueryFoundation CSSOwl CarouselYoast SEO
2026-07-05T07:16:34.831Z
numc.edu favicon

NuHealth

numc.edu

50
HealthcareUnited StateslargeMEDIUM

Nassau University Medical Center (NUMC), operating under the NuHealth system, is a large healthcare provider and teaching hospital located in East Meadow, New York. Established in 1935, it serves as the primary medical care source for Nassau County. The website presents a comprehensive range of healthcare services including maternity, bariatric surgery, mental health, emergency care, and primary care, targeting patients, visitors, and medical professionals. The institution maintains a strong market position with multiple centers of care and community partnerships. Technically, the website is built on WordPress with modern frameworks like Bootstrap and integrates Google Analytics and Tag Manager for tracking. It supports multiple languages via GTranslate and implements Google reCAPTCHA for form security. Security posture is good with HTTPS enforced and no visible vulnerabilities, though security headers are not explicitly detected. Privacy compliance is basic, with a privacy policy present but lacking explicit cookie consent mechanisms. WHOIS data is missing, which reduces domain transparency but the website content and external references strongly support legitimacy. Overall, the site is professional, secure, and user-friendly, with room for improvement in privacy and security disclosures.

47
85
75
40
15
53
2
healthcarehospitalmedicalcenterpatientcareeducation+2 more
WordPressYoast SEOGoogle AnalyticsGoogle Tag Manager+5

Partner Domains:

harmonyhealthcareli.org
partner
numc.followmyhealth.com
service
2026-07-05T07:12:20.418Z
albinandco.co.uk favicon

Albin & Co Ltd

albinandco.co.uk

51
OtherUnited KingdomsmallMEDIUM

Albin & Co Ltd is a well-established UK-based legal services firm specializing in criminal, prison, military, family, children, and motoring law. The company serves clients primarily in Reading, Berkshire, and surrounding areas, offering legal advice and representation in police stations and courts. The firm maintains a strong market position supported by verified client reviews and professional accreditations such as the SRA Digital Badge. The website reflects a professional and consistent brand image with clear service offerings and contact information. Technically, the website is built on WordPress using the Enfold theme and Avia framework, incorporating modern SEO practices and third-party integrations like Google Analytics and ReviewSolicitors widgets. Hosting is provided by Krystal Hosting Ltd, a reputable UK provider. The site demonstrates good mobile optimization and moderate performance, with room for improvement in accessibility and cookie consent compliance. From a security perspective, the website enforces HTTPS and avoids exposing sensitive data. However, it lacks visible security headers and dedicated security or incident response policies. Privacy compliance is partial, with a comprehensive privacy policy present but no cookie consent mechanism detected. The domain WHOIS data is consistent and supports the legitimacy of the business. Overall, the website presents a trustworthy and professional front for Albin & Co Ltd, with recommendations to enhance privacy compliance and security transparency to further strengthen user trust and regulatory adherence.

57
65
75
20
17
20
73
legalsolicitorscriminallawfamilylawprisonlaw+5 more
WordPressYoast SEOjQueryGoogle Analytics+1

Partner Domains:

www.reviewsolicitors.co.uk
partner
2026-07-05T07:00:56.592Z
B

Barons Pub Company Ltd

baronspubs.com

56
HospitalityUnited KingdommediumMEDIUM

Barons Pub Company Ltd is a well-established independent pub group operating 11 traditional, family-friendly pubs across Surrey, Berkshire, and West Sussex. Founded in 2000, the company has built a strong reputation for excellent food, service, and community engagement. Their offerings include diverse menus catering to various dietary needs, event hosting with buffet options, and outdoor dining facilities. The company also operates an online shop and recruitment portal, indicating a mature digital presence. Technically, the website is built on WordPress with modern JavaScript libraries and tracking tools such as Google Tag Manager, Facebook Pixel, and Microsoft Clarity. The site is well-optimized for SEO and accessibility, with responsive design and clear navigation. Cookie consent mechanisms and privacy policies are in place, reflecting good privacy compliance practices. From a security perspective, the site enforces HTTPS and uses cookie consent banners but lacks explicit security headers and published security policies. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data is a concern and should be investigated further to confirm domain registration legitimacy. Overall, the website presents a professional and trustworthy digital front for the business, with moderate to high scores in content quality, technical implementation, security posture, privacy compliance, and business credibility. Strategic recommendations include enhancing security headers, publishing a security policy, and verifying domain registration details to strengthen trust and compliance.

75
75
40
37
2
83
50
pubshospitalityfamily-friendlysurreyberkshire+4 more
jQueryGoogle Tag ManagerFacebook PixelMicrosoft Clarity+3

Partner Domains:

shop.baronspubs.com
partner
jobs.baronspubs.com
partner
2026-07-04T07:27:39.905Z
fosterfarms.com favicon

Foster Farms

fosterfarms.com

64
RetailUnited StateslargeMEDIUM

Foster Farms is a well-established poultry company specializing in premium chicken and turkey products, targeting general consumers seeking fresh, natural, and organic protein options. The company maintains a strong market presence on the West Coast of the United States, offering a range of fresh whole chickens and ready-to-eat meals. Their website reflects a mature digital presence with professional branding and consistent messaging aligned with their business model. Technically, the website is built on WordPress with integration of modern marketing and analytics tools such as Google Tag Manager and Bazaarvoice. The site is mobile-optimized and employs SEO best practices, although some accessibility features could be enhanced. Performance is moderate, with no significant technical debt observed. From a security perspective, the site enforces HTTPS and includes standard security headers, contributing to a good security posture. However, there is a lack of publicly available security policies, incident response contacts, and vulnerability disclosure mechanisms, which are recommended for improving transparency and trust. Privacy compliance is strong, with clear privacy and cookie policies and a consent mechanism in place. Overall, the website presents a low-risk profile with good business credibility and technical implementation. The main limitation is the absence of WHOIS data, which reduces domain registration trust verification. Strategic recommendations include publishing security policies, adding incident response information, and enhancing accessibility and security transparency.

80
100
47
85
65
2
53
poultryfoodretailorganicchicken+5 more
WordPressYoast SEOGoogle Tag ManagerBazaarvoice+1
2026-07-04T07:21:22.296Z
cullimoredutton.co.uk favicon

Cullimore Dutton Solicitors Limited

cullimoredutton.co.uk

56
Real EstateUnited KingdommediumMEDIUM

Cullimore Dutton Solicitors Limited is a well-established legal and financial advisory firm based in Cheshire, UK, with a heritage dating back to 1792. The company offers a broad range of services including family law, property conveyancing, estate planning, and independent financial advice, targeting individuals, families, and business owners in the Cheshire and Chester region. The firm positions itself as a trusted local advisor providing joined-up legal and financial services under one roof, emphasizing clarity, respect, and professionalism. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Yoast SEO for search optimization, Contact Form 7 for user inquiries, and Google reCAPTCHA for spam protection. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate, with room for improvement in security headers and some external tracking domains. From a security perspective, the website enforces HTTPS and uses reCAPTCHA on forms, indicating a good baseline security posture. However, there is no explicit evidence of advanced security headers or a published security policy or incident response plan. The WHOIS lookup for the domain failed due to a naming rules error, but the domain is active and professionally maintained, suggesting legitimacy despite incomplete WHOIS data. Overall, the website is professional, trustworthy, and compliant with privacy regulations, including GDPR. The main risks relate to incomplete WHOIS data and minor security header omissions. Strategic improvements in security policy transparency and header implementation would enhance the security posture and trustworthiness further.

70
80
57
40
83
17
15
legalsolicitorscheshirefinancialadvicefamilylaw+3 more
jQueryYoast SEOContact Form 7Google reCAPTCHA+1
2026-07-04T07:18:31.729Z
jaderecruitment.net favicon

Jade Recruitment

jaderecruitment.net

46
OtherUnited KingdomsmallHIGH

Jade Recruitment Ltd is a well-established recruitment agency operating primarily in Surrey and Hampshire, UK, since 1987. The company specializes in matching candidates with temporary and permanent job opportunities across commercial, catering, care, and industrial sectors. They also provide HR consultancy services to employers lacking in-house HR teams. The website reflects a professional business with clear service offerings, a focus on local recruitment, and a strong emphasis on personalized candidate-employer matching. Their market position is that of a trusted local agency with longstanding client relationships. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, WP Job Manager, and Slider Revolution. It employs Google Analytics for visitor tracking and is optimized for mobile devices with good SEO practices. Performance is moderate, with room for improvement in accessibility and security headers. The site uses HTTPS with a valid SSL certificate, ensuring secure communications. From a security perspective, the site demonstrates basic good practices such as HTTPS enforcement and no visible sensitive data exposure. However, it lacks advanced security headers and a published incident response or vulnerability disclosure policy. Privacy compliance is partially addressed with privacy and cookie policies present, though no explicit cookie consent mechanism is implemented. The absence of WHOIS data for the domain raises concerns about domain registration legitimacy, which should be further investigated. Overall, Jade Recruitment presents a credible and professional online presence with a solid business foundation. Strategic improvements in security posture, privacy compliance, and domain registration transparency would enhance trust and reduce risk exposure.

57
75
55
-
15
2
85
recruitmentjobshrconsultancysurreyhampshire+2 more
WordPressPHPjQueryGoogle Analytics+3
2026-07-04T07:14:08.261Z
ukpworldwide.com favicon

UKP Worldwide

ukpworldwide.com

46
OtherUnited KingdomsmallHIGH

UKP Worldwide is a specialist service provider focusing on customs clearance for eCommerce parcels and mail to and from the UK, including returns management and duty reclaim services. The company targets businesses involved in eCommerce logistics, offering niche expertise in customs and returns processes. The website presents a professional and consistent brand image with clear business descriptions and social media presence, indicating a small but focused operation founded around 2019. Technically, the website is built on WordPress using the Divi theme and common plugins such as Yoast SEO and Contact Form 7. It employs tracking and analytics tools like Microsoft Clarity and Google Tag Manager, indicating a moderate level of digital maturity. The site is mobile optimized and SEO friendly but lacks advanced accessibility features. From a security perspective, the website lacks visible security headers and explicit privacy or cookie policies, which reduces its compliance posture. The WHOIS data is incomplete or unavailable, raising concerns about domain registration transparency. No critical vulnerabilities or exposed sensitive data were detected, but improvements in security best practices and compliance documentation are recommended. Overall, the website is functional and professional but would benefit from enhanced security configurations, transparent privacy policies, and verified domain registration information to improve trust and compliance.

70
20
70
57
68
15
2
customsclearanceecommercereturnsmanagementdutyreclaimlogistics+1 more
Google Tag ManagerMicrosoft ClarityYoast SEOContact Form 7+2
2026-07-04T07:10:26.611Z
R

Responsive Engineering

responsive-engineering.com

45
ManufacturingUnited KingdomlargeHIGH

Responsive Engineering is a well-established contract manufacturing company based in the North East of England, specializing in large, complex fabrications primarily serving the Energy, Defence, and Rail sectors. The company operates from a large facility and offers a comprehensive range of manufacturing services including machining, welding, cutting, fabrication, pressing, assembly, inspection, testing, and coating. Their market position is that of a trusted regional manufacturer with certifications such as ISO 9001 and NQA UKAS, indicating a commitment to quality and compliance. The website reflects a professional business presence with good content quality and clear navigation tailored to industrial clients. Technically, the website is built on WordPress with common libraries such as jQuery, Slick Slider, and Fancybox, and uses Matomo for analytics, indicating a moderate level of digital maturity with some privacy-conscious choices. The site is mobile-optimized and SEO-friendly but lacks some advanced accessibility features. Performance is moderate with room for improvement in technical infrastructure, especially regarding security headers and DNSSEC. From a security perspective, the site enforces HTTPS and has domain transfer protections but lacks DNSSEC and explicit security headers, which are recommended for enhanced security. There is no visible privacy or cookie policy, which is a compliance gap, especially under GDPR. The presence of a suspicious external script from ever-track-51.com warrants review. Overall, the security posture is adequate but could be improved with better policy disclosures and technical safeguards. The overall risk assessment is moderate with a good business credibility score but some privacy and security compliance gaps. Strategic recommendations include implementing comprehensive privacy and cookie policies with consent mechanisms, enabling DNSSEC, adding security headers, auditing third-party scripts, and considering a vulnerabi…

47
20
80
85
2
35
15
manufacturingengineeringcontractfabricationenergydefence+4 more
jQuerySlick SliderFancyboxMatomo Analytics+1
2026-07-03T07:26:33.264Z
jmdaccounting.com favicon

JMD Accounting Ltd

jmdaccounting.com

60
FinanceUnited KingdomsmallMEDIUM

JMD Accounting Ltd is a small, professional accounting and bookkeeping service provider based in Surrey, United Kingdom. The company specializes in tax accounting services tailored for small businesses, offering a comprehensive range of services including Making Tax Digital support, payroll, VAT returns, self-assessment, and company filings. The business is led by Janette Dalgliesh, a qualified CIMA member since 1996, emphasizing expertise and trustworthiness in the financial services sector. The website reflects a focused local market position with clear contact channels and professional branding. Technically, the website is built on WordPress using Elementor and several popular plugins such as Slider Revolution, Yoast SEO, and WPForms. It employs modern web technologies and integrates Google Analytics and Google reCAPTCHA v3 for user tracking and form security. The site is mobile-optimized and demonstrates good SEO practices, although some security headers are missing and DNSSEC is not enabled, which are areas for improvement. From a security perspective, the site uses HTTPS with a valid SSL certificate and implements reCAPTCHA on forms to mitigate spam. Privacy and cookie policies are present and GDPR compliant, with a functional consent mechanism. However, there is no explicit security policy or incident response information published, and no vulnerability disclosure or security.txt file is found. The WHOIS data is consistent with the business claims, showing a domain registered since 2007, supporting the legitimacy and stability of the company. Overall, JMD Accounting Ltd presents a trustworthy and professional online presence with solid business credibility and a good security posture. Minor enhancements in security headers, DNSSEC, and transparency around incident response could further strengthen their digital maturity and customer trust.

15
80
2
70
57
70
100
accountingbookkeepingtaxsmallbusinesssurrey+6 more
WordPressElementorSlider RevolutionYoast SEO+5
2026-07-03T07:25:31.515Z