Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157325
Websites
130
Industries
113
Countries
52
Avg Score
Page 7 of 28|Showing 301-350 of 1385
motor.com favicon

MOTOR Information Systems

motor.com

68
TransportationUnited StateslargeMEDIUM

MOTOR Information Systems, a division of Hearst Business Publishing, operates as a global leader in automotive data solutions, offering a comprehensive suite of software applications, data products, data services, manuals, and insights tailored for various automotive industry segments including service providers, OEMs, parts suppliers, fleets, and technology providers. The company has a long-standing history dating back to 1903 and serves a large client base with a strong market position. Technically, the website is built on WordPress with modern SEO and analytics integrations, including Google Analytics, HubSpot, and CookieYes for privacy compliance. The site demonstrates excellent design, mobile optimization, and accessibility, reflecting a mature digital presence. Security-wise, the site enforces HTTPS and employs standard security headers, but lacks a publicly available security policy or incident response information, which could be improved. The absence of WHOIS registration data is a notable anomaly but does not significantly detract from the overall legitimacy given the strong branding and association with Hearst. Overall, the website is professional, secure, and privacy-conscious, with room for enhanced transparency in security governance.

40
88
25
85
47
80
100
automotivedatasolutionsb2bsaasprivacycompliant+2 more
jQueryGoogle Tag ManagerGoogle AnalyticsHubSpot+3

Partner Domains:

hearst.com
parent
2025-10-18T18:17:49.085Z
antithesis.com favicon

Antithesis Operations LLC

antithesis.com

74
TechnologyUnited StatessmallMEDIUM

Antithesis Operations LLC operates a sophisticated autonomous software testing platform designed to identify and reproduce bugs in complex distributed systems, with a focus on fintech, blockchain, databases, and cloud infrastructure sectors. The company positions itself as an innovative leader in autonomous testing, providing deterministic simulation testing that enhances software reliability and reduces time-to-resolution for critical bugs. Their website reflects a mature, professional business with strong trust signals including customer testimonials and SOC 2 Type 2 certification. Technically, the website employs modern JavaScript frameworks, analytics tools such as PostHog and HubSpot, and is hosted with Amazon Registrar, indicating a robust digital infrastructure. The site is well-optimized for mobile devices, has good SEO practices, and offers a seamless user experience. However, there is room for improvement in DNS security and cookie consent mechanisms. From a security perspective, the company demonstrates good practices with HTTPS enforcement, domain status protections, and a dedicated security manifesto page. The absence of DNSSEC and explicit security headers, as well as lack of a vulnerability disclosure policy, represent minor gaps. The contact form is well-validated and includes anti-bot measures, enhancing security posture. Overall, Antithesis presents a low-risk profile with a strong business and technical foundation. Strategic improvements in DNS security, privacy compliance, and vulnerability disclosure would further enhance their security maturity and trustworthiness.

65
68
17
85
90
85
100
softwaretestingautonomoustestingdistributedsystemsfintechblockchain+3 more
JavaScriptPostHog analyticsHubSpotGoogle Tag Manager+3
2025-10-18T07:07:53.005Z
myadlm.org favicon

Association for Diagnostics & Laboratory Medicine

myadlm.org

64
HealthcareUnited StatesmediumMEDIUM

The Association for Diagnostics & Laboratory Medicine (ADLM) is a professional organization focused on laboratory medicine and clinical chemistry. Founded recently in 2023, it serves a global community of clinical laboratorians, researchers, and healthcare professionals by providing educational resources, advocacy, networking opportunities, and scientific publications. The website reflects a mature and professional association with a strong emphasis on community engagement, education, and scientific advancement. ADLM positions itself as a key player in laboratory medicine with a comprehensive portfolio of services including conferences, journals, and certification programs. Technically, the website is built on a modern stack including Sitecore CMS, HubSpot marketing tools, Coveo search integration, and Cloudflare DNS services. The site is mobile-optimized, accessible, and SEO-friendly, though performance is moderate. The domain is registered with GoDaddy and protected with multiple EPP statuses, indicating a stable and legitimate registration. However, DNSSEC is not enabled, and security headers are not visibly configured, which are areas for improvement. From a security perspective, the site uses HTTPS and has protections against domain hijacking. Tracking and marketing scripts are present, but no explicit cookie consent mechanism was found, which may impact GDPR compliance. No incident response or security policy information is publicly available. Overall, the security posture is good but could be enhanced by adding security headers, enabling DNSSEC, and implementing privacy compliance features. The overall risk assessment is low with high trustworthiness and professionalism. Strategic recommendations include improving privacy compliance, enhancing security headers, and publishing security policies to increase transparency and user trust.

20
73
17
72
65
80
100
healthcarelaboratorymedicineeducationprofessionalassociationscientificresearch+1 more
JavaScriptjQueryHubSpotGoogle Tag Manager+2

Partner Domains:

harmonization.net
partner
comacc.org
partner

+2 more partners

2025-10-17T17:57:46.550Z
multiview.com favicon

Multiview

multiview.com

67
MediaN/amediumMEDIUM

Multiview is a professional B2B digital media agency specializing in marketing services for associations and businesses. The company focuses on helping clients reach, engage, and grow their most valued relationships through digital marketing strategies. Their market position is that of an established and reputable service provider in the B2B marketing space, leveraging modern marketing technologies and platforms such as HubSpot. The website reflects a medium-sized enterprise with consistent branding and good content quality. Technically, the website is built on the HubSpot CMS platform and integrates a variety of marketing and analytics tools including Google Analytics 4, Hotjar, Adobe DTM, and Snap Pixel. The site is mobile optimized and demonstrates good SEO and accessibility practices, although some accessibility features could be enhanced. Performance is moderate, with a modern tech stack and proper meta tags. From a security perspective, the site enforces HTTPS, uses security headers, and employs reCAPTCHA Enterprise to protect forms. Cookie consent mechanisms are in place, indicating GDPR compliance. However, the absence of a published security policy, incident response plan, and vulnerability disclosure program are gaps that could be addressed to improve security posture and transparency. Overall, the website is professional and trustworthy, but the lack of WHOIS data and domain registration details introduces some uncertainty about domain legitimacy. Strategic recommendations include publishing explicit security and incident response policies, implementing a vulnerability disclosure program, and enhancing accessibility compliance to further strengthen the site's security and trustworthiness.

45
88
17
75
65
65
100
b2bdigitalmarketingmediaagencymarketingservicesprivacy+3 more
jQueryGoogle Analytics 4HubSpotHotjar+4
2025-10-17T17:56:31.362Z
traceinternational.org favicon

TRACE International, Inc.

traceinternational.org

65
Non-profitN/amediumMEDIUM

TRACE International, Inc. operates as a non-profit organization providing compliance tools and resources to companies aiming to adhere to anti-bribery laws such as the U.S. Foreign Corrupt Practices Act and the UK Bribery Act. Their business model is membership-based, pooling dues to develop shared compliance resources including eLearning and a member resource center. The organization is positioned as a globally recognized compliance community resource with a focus on ethical business practices. Technically, the website employs modern web technologies including Nuxt.js, jQuery, Bootstrap, and integrates third-party services such as HubSpot for marketing and analytics. The site is hosted partially on Microsoft Azure Blob Storage for media assets and demonstrates moderate performance with good mobile optimization and basic accessibility features. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data limits the ability to fully verify domain legitimacy, though the website content and branding suggest a professional and trustworthy organization. Overall, the website presents a solid compliance-focused resource with good content quality and technical implementation. Enhancements in security headers and transparency around security policies would strengthen its security posture and trustworthiness.

40
83
2
70
65
80
100
complianceanti-briberymembershipelearningnon-profit+1 more
jQueryBootstrapFontAwesomeSlick Carousel+2
2025-10-17T15:18:11.117Z
nodesource.com favicon

NodeSource

nodesource.com

61
TechnologyN/amediumMEDIUM

NodeSource is a technology company specializing in providing advanced Node.js performance and security solutions for mission-critical applications. Their product suite includes N|Solid, N|Solid Copilot, and N|Solid Runtime, complemented by expert services such as consulting, training, and legacy support. The company targets organizations and developers seeking to optimize and secure their Node.js environments, boasting reputable clients like NASA and Mastercard. The website reflects a mature, professional business with a strong market position in the Node.js ecosystem. Technically, the website is built on modern frameworks including Next.js and React, hosted likely on AWS infrastructure, and integrates various marketing and analytics tools such as Google Tag Manager and HubSpot. The site is well-optimized for performance, mobile responsiveness, and SEO, providing an excellent user experience. From a security perspective, the site enforces HTTPS and domain registration protections but lacks DNSSEC and explicit security or incident response policies. Privacy compliance is partially addressed with privacy and cookie policies present, though no active cookie consent mechanism is implemented. Contact information is primarily via web forms, with no direct emails or phone numbers published. Overall, NodeSource demonstrates a strong security posture and business credibility, with minor improvements recommended in DNS security and privacy consent mechanisms to enhance trust and compliance.

15
53
2
85
62
85
100
nodejsperformancesecurityaiobservability+2 more
ReactNext.jsJavaScriptAWS (Amazon Registrar, AWS DNS servers)+4
2025-10-17T07:16:58.214Z
pixl8.com favicon

Pixl8 Group Limited

pixl8.com

10
TechnologyUnited KingdommediumCRITICAL

Pixl8 Group Limited is a UK-based technology company specializing in digital engagement solutions for membership organizations, associations, and charities. With over 20 years of experience, they provide a range of services including technology consultancy, website development, data optimization, UX design, systems integration, and digital analytics. The company serves over 200 not-for-profit clients globally and maintains offices in the UK, USA, Australia, and Malaysia. Their market position is that of a trusted specialist partner in the membership and charity sectors, supported by ISO 27001 certification and strong client testimonials. Technically, the website is built on a modern stack including Bootstrap, jQuery, and Preside CMS, with integrations for analytics and marketing tools such as Google Analytics, Piwik PRO, HubSpot, and multiple social media pixels. The site is mobile-optimized and demonstrates good SEO and accessibility practices, although some accessibility features could be improved. Hosting and DNS are managed via Cloudflare, but DNSSEC is not enabled. From a security perspective, Pixl8 shows a mature posture with HTTPS enforced, domain status protections, and ISO 27001 certification. The cookie consent mechanism is robust and GDPR compliant. However, explicit security headers like Content-Security-Policy are not detected, and no public incident response or vulnerability disclosure information is available. No critical vulnerabilities or exposed sensitive data were found. Overall, the website and business present a low-risk profile with strong trust indicators and compliance adherence. Strategic recommendations include enabling DNSSEC, publishing incident response contacts, and enhancing security headers to further strengthen security posture.

-
-
-
-
-
-
-
technologymembershipnon-profitdigitalagencyconsultancy+5 more
Google Tag ManagerGoogle AnalyticsPiwik PROHubSpot+3

Partner Domains:

readymembership.com
partner
2025-10-17T07:11:31.419Z
passportusa.com favicon

Health Carousel International - PassportUSA Program

passportusa.com

66
HealthcareUnited StateslargeMEDIUM

Health Carousel International operates the PassportUSA program, a leading international healthcare staffing agency specializing in connecting skilled nurses and healthcare professionals with top US healthcare facilities. The company holds a strong market position as the largest international nurse staffing firm in the US, supported by multiple industry certifications and awards. Their services include visa sponsorship, career advancement, and ethical recruitment practices, targeting internationally trained healthcare professionals seeking US careers. Technically, the website is built on a modern stack including Webflow CMS, HubSpot, Segment Analytics, and various JavaScript libraries for enhanced user experience and analytics. The site is well-optimized for performance, mobile responsiveness, and SEO, with extensive tracking and marketing tools integrated. Security posture is strong with HTTPS, security headers, and secure form handling, though formal security policies and incident response contacts are not publicly disclosed. Overall, the website demonstrates a mature digital presence with professional design, comprehensive content, and strong trust indicators. The lack of WHOIS data reduces transparency but is likely due to privacy protection. No security vulnerabilities or suspicious content were detected, indicating a low risk profile. Strategic recommendations include publishing security policies, adding vulnerability disclosure mechanisms, and enhancing accessibility features.

30
68
2
83
72
85
100
healthcarenursingstaffingvisasponsorshipinternationalrecruitment+2 more
jQueryHubSpotSegment AnalyticsGoogle Tag Manager+6

Partner Domains:

healthcarousel.com
parent
healthcarouselphilippines.com
subsidiary

+1 more partners

2025-10-17T01:02:59.453Z
ofa-bamberg.com favicon

Ofa Bamberg GmbH

ofa-bamberg.com

52
HealthcareGermanymediumMEDIUM

Ofa Bamberg GmbH is a well-established German company specializing in high-quality medical compression and orthopaedic products, with a history dating back to 1928. The company serves a global market, exporting to over 40 countries, and targets healthcare professionals and patients requiring phlebological and orthopaedic solutions. Their product range includes compression stockings, orthopaedic supports, and preventive health products, supported by digital tools such as a product finder and comprehensive knowledge resources. Technically, the website is built on a modern stack including HubSpot CMS, jQuery, and various carousel libraries, with integrations for Google Analytics and Facebook Pixel for marketing and analytics. The site is mobile-optimized and SEO-friendly, though some accessibility features are basic. Performance is moderate, with room for optimization. Security posture is generally good with HTTPS enforced and cookie consent implemented, but the absence of several key security headers suggests potential improvements. No critical vulnerabilities were detected in the visible content. Privacy compliance is strong, with clear privacy and cookie policies aligned with GDPR requirements. Overall, the website presents a professional and trustworthy digital presence for Ofa Bamberg GmbH. However, the lack of WHOIS data for the domain introduces some uncertainty regarding domain registration legitimacy. This may be a technical anomaly rather than a risk indicator. Strategic recommendations include enhancing security headers, maintaining privacy compliance, and investigating the WHOIS data issue to ensure full transparency and trust.

45
65
17
45
62
85
20
healthcaremedicalcompressionorthopaedicsphlebologycompressionstockings+2 more
jQuerySlick CarouselHubSpotGoogle Analytics+3

Partner Domains:

portal.ofa24.de
partner
www.ofa.de
partner

+1 more partners

2025-10-16T16:12:59.011Z
channelsight.com favicon

ChannelSight

channelsight.com

51
TechnologyIrelandmediumMEDIUM

ChannelSight is a technology company specializing in AI-powered ecommerce optimization solutions. Their platform focuses on enhancing online product performance and maximizing conversions across the consumer journey. Positioned as a market leader, ChannelSight offers key services including Where To Buy solutions, Shoppable Media, and Digital Shelf analytics, targeting brands and marketers aiming to optimize ecommerce sales. The company operates primarily in Ireland and serves a medium-sized business profile. Technically, the website is built on a modern Webflow CMS platform, leveraging a robust tech stack including Google Tag Manager, HubSpot, Zoho SalesIQ, Hotjar, and LinkedIn Insight Tag. The site demonstrates excellent performance, mobile optimization, and SEO practices, reflecting a mature digital infrastructure. The use of advanced animation libraries and smooth scrolling enhances user experience. From a security perspective, the site enforces HTTPS and employs a consent management platform for privacy compliance. While explicit security headers are not fully evident, the overall security posture is strong with no exposed sensitive data or vulnerabilities detected. Privacy policies and cookie consent mechanisms are comprehensive and GDPR compliant, supporting a trustworthy user environment. Overall, ChannelSight presents a professional, secure, and well-structured online presence with strong business credibility. The incomplete WHOIS data suggests privacy protection but does not detract significantly from trust given the quality of the website and business information. Strategic recommendations include enhancing security headers, publishing a vulnerability disclosure policy, and improving incident response visibility to further strengthen security and compliance.

-
-
-
77
72
75
100
ecommerceaidigitalshelfmarketinganalytics+2 more
Webflow CMSGoogle Tag ManagerHubSpotZoho SalesIQ+5
2025-10-16T16:09:38.849Z
insightassurance.com favicon

Insight Assurance

insightassurance.com

78
TechnologyN/asmallLOW

Insight Assurance is a specialized cybersecurity and compliance consultancy founded in 2020, offering a broad range of services including compliance audits, security assessments, and certifications across major frameworks such as SOC 2, GDPR, ISO 27001, HITRUST, PCI DSS, FedRAMP, and CMMC. The company targets businesses of all sizes, from startups to enterprise organizations, helping them reduce cyber risk and maintain regulatory compliance with expert-led solutions. Their market position is that of a trusted, professional service provider with a consistent brand and strong trust indicators including certifications and social media presence. Technically, the website is built on WordPress using Elementor and Yoast SEO, hosted with Cloudflare as registrar and DNS provider. The site employs modern marketing and analytics tools such as Google Tag Manager, HubSpot, and AdRoll, and implements security best practices including HTTPS, reCAPTCHA, and cookie consent mechanisms. Performance and mobile optimization are good, with room for improvement in accessibility and security headers. The security posture is solid with no detected vulnerabilities or exposed sensitive data. However, DNSSEC is not enabled and some security headers could be added to enhance protection. Incident response information and vulnerability disclosure mechanisms are not explicitly provided, which could be improved to increase transparency and readiness. Overall, Insight Assurance presents a professional, trustworthy online presence with comprehensive compliance and security services. Strategic recommendations include enabling DNSSEC, publishing a security.txt file, enhancing security headers, and providing explicit incident response contacts to further strengthen security and compliance posture.

40
85
52
100
75
85
100
cybersecuritycompliancesoc2gdpriso27001+5 more
WordPressElementorYoast SEOGoogle Tag Manager+3
2025-10-16T11:27:59.413Z
I

InterSystems Corporation

intersystems.com

58
TechnologyUnited StatesenterpriseMEDIUM

InterSystems Corporation is a leading enterprise software company specializing in data management and healthcare information systems. The company offers a broad portfolio of high-performance, cloud-first platforms designed to make data AI-ready, clean, and accessible across industries such as healthcare, finance, manufacturing, and supply chain. Positioned as a market leader, InterSystems competes with major cloud and data platform providers and is recognized in industry rankings such as the ISG/Ventana Buyers Guide. The website reflects a mature digital presence with comprehensive product information, customer success stories, and developer resources. Technically, the site employs modern web technologies, including Google Tag Manager, HubSpot, and OneTrust for privacy compliance, and is hosted on a robust CDN infrastructure likely powered by Akamai. Security posture is strong with HTTPS enforcement, security headers, and cookie consent mechanisms, though explicit vulnerability disclosure and incident response contacts are not publicly detailed. Overall, the website and business presence indicate a trustworthy and professional enterprise with a focus on data-driven digital transformation.

-
58
47
85
-
85
100
datamanagementhealthcareitcloudservicesinteroperabilityfhir+2 more
JavaScriptGoogle Tag ManagerOneTrust Cookie ConsentHubSpot+1

Partner Domains:

developer.intersystems.com
partner
community.intersystems.com
partner

+2 more partners

2025-10-16T04:06:33.418Z
levelpath.com favicon

Levelpath

levelpath.com

61
TechnologyN/amediumMEDIUM

Levelpath is a technology company offering an AI-native procurement platform designed to simplify and enhance procurement processes for enterprises. The company positions itself as a leader in AI-driven procurement solutions, recognized by Gartner as a Cool Vendor in sourcing and procurement technology. Their platform includes modules such as Front Door to Procure, Sourcing, Pipeline, Contracts, and Risk Management, targeting enterprise customers seeking efficiency and innovation in procurement. Technically, the website is built using modern frameworks like Next.js and React, hosted likely behind Cloudflare, and integrates multiple marketing and analytics tools including HubSpot, Google Tag Manager, and Microsoft Clarity. The site is well optimized for performance, mobile responsiveness, and SEO, providing an excellent user experience. From a security perspective, the site enforces HTTPS and implements a comprehensive cookie consent mechanism with detailed categories. However, it lacks visible security headers and published security policies or incident response information. The absence of WHOIS registration data raises some concerns about domain legitimacy, though the professional web presence and business signals mitigate this risk. Overall, Levelpath presents a strong digital and business profile with room for improvement in transparency around privacy policies, security disclosures, and domain registration information. Strategic recommendations include publishing explicit privacy and security policies, enhancing security headers, and verifying domain registration details to strengthen trust and compliance.

20
83
17
75
52
65
100
aiprocurementtechnologysaasenterprise+4 more
Next.jsReactVimeo PlayerHubSpot+4
2025-10-15T12:26:19.119Z