Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 7 of 128|Showing 301-350 of 6391
W

Wrigleys Solicitors LLP

wrigleys.co.uk

64
OtherUnited KingdommediumMEDIUM

Wrigleys Solicitors LLP is a well-established specialist law firm operating primarily in the UK with offices in Leeds, Sheffield, and Newcastle. The firm focuses on advising private clients, charities, trustees, and businesses in sectors such as trusts, tax, pensions, property, agriculture, education, and employment law. Their market position is reinforced by multiple industry certifications and recognitions, including Legal 500 and Chambers rankings. The website reflects a professional and comprehensive digital presence with clear navigation and rich content tailored to their target audience. Technically, the website employs modern web technologies including jQuery, Bootstrap, Google Analytics, Google Tag Manager, and Google reCAPTCHA for security on forms. The site is mobile-optimized and demonstrates good SEO practices. While no explicit CMS or hosting provider was identified, the infrastructure appears stable and performant. From a security perspective, the site uses HTTPS with a strong SSL configuration and implements cookie consent and CAPTCHA mechanisms to protect user data and prevent abuse. However, security headers are not explicitly detected and no public security or incident response policies are found, indicating room for improvement in transparency and defense-in-depth. Overall, the website is trustworthy and professional with no signs of malicious activity or content safety concerns. The lack of WHOIS data due to domain query failure limits full domain legitimacy verification, but the business credentials and content strongly support authenticity. Strategic recommendations include enhancing security headers, publishing incident response information, and continuous monitoring of third-party scripts.

57
85
70
100
30
68
17
lawlegalsolicitorstrustspensions+4 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle reCAPTCHA+5
2026-07-03T07:06:52.756Z
E

Eagle Overseas

eagleoverseas.com

60
TransportationUnited KingdomsmallMEDIUM

Eagle Overseas is a UK-based logistics service provider specializing in transport, warehousing, and customs clearance. The company has a well-established online presence with a domain registered since 2000, indicating long-term business operations. The website is built on WordPress using the Divi theme and incorporates standard plugins such as Gravity Forms and Google reCAPTCHA to facilitate user interaction and spam protection. Google Analytics is employed for visitor tracking, reflecting a moderate level of digital maturity. From a security perspective, the website benefits from HTTPS encryption and domain transfer protection, but lacks advanced DNS security measures such as DNSSEC. The absence of a published privacy policy, terms of service, and vulnerability disclosure documents indicates gaps in compliance and transparency. The cookie consent mechanism is present and functional, supporting GDPR compliance to some extent. No critical security vulnerabilities or malicious content were detected during the analysis. Overall, Eagle Overseas demonstrates a moderate security posture with room for improvement in privacy compliance and security best practices. The website quality and user experience are good, supporting the company's business objectives effectively. Strategic enhancements in security headers, policy documentation, and DNS security would strengthen trust and regulatory adherence.

70
70
32
100
25
95
17
transportwarehousingcustomslogisticswordpress+3 more
WordPressDivi ThemejQueryGravity Forms+3
2026-07-03T07:06:30.333Z
kdmevents.co.uk favicon

KDM Events Ltd

kdmevents.co.uk

59
OtherUnited KingdommediumMEDIUM

KDM Events Ltd is a UK-based corporate events management company specializing in team building, conferences, and corporate event services. The company positions itself as an award-winning provider delivering services across the UK, targeting corporate clients seeking professional event planning and management. Their key offerings include team building activities, conference management, audio visual services, content and design, audience engagement, and awards ceremonies. The website reflects a medium-sized business with a professional and consistent brand presence. Technically, the website is built on WordPress and leverages a modern technology stack including jQuery, Google Analytics, Google Tag Manager, Google reCAPTCHA, New Relic monitoring, and CookieYes for consent management. The site is mobile optimized and demonstrates good SEO practices with structured data and meta tags. Performance is moderate with room for improvement in accessibility. From a security perspective, the site enforces HTTPS, uses reCAPTCHA to mitigate spam, and implements cookie consent mechanisms. However, it lacks visible security headers and does not publish a privacy policy or terms of service within the analyzed content. The WHOIS data is unavailable or invalid, raising concerns about domain registration legitimacy, although the website content itself appears professional and trustworthy. Overall, the website presents a solid business and technical foundation but should address privacy policy publication, improve security headers, and clarify domain registration details to enhance trust and compliance.

37
100
70
60
20
17
95
corporateeventsteambuildingconferencemanagementukbusinesseventplanning
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+9
2026-07-02T07:21:22.771Z
nortonpeskett.co.uk favicon

Norton Peskett Solicitors

nortonpeskett.co.uk

48
OtherUnited KingdommediumHIGH

Norton Peskett Solicitors is a well-established law firm based in East Anglia, UK, with a history dating back to the 1830s. The firm offers a comprehensive range of legal services to both individuals and businesses, including criminal defence, family law, employment law, residential and commercial property, injury claims, mediation, and wills and probate. With multiple branch offices and over 120 experienced employees, Norton Peskett holds a strong regional market position supported by numerous accreditations and client testimonials. The website reflects a professional and trustworthy business with clear contact information and a user-friendly design. Technically, the website is built on WordPress 7.0 with modern SEO and analytics tools such as Yoast SEO, Google Analytics, Google Tag Manager, and Hotjar. It employs HTTPS with good SSL configuration and uses Google reCAPTCHA to secure forms. Cookie consent mechanisms and a privacy policy indicate GDPR compliance. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contact is published. From a security perspective, the site demonstrates good practices including HTTPS enforcement, anti-phishing warnings, and form protection. The absence of WHOIS data is unusual but likely due to querying the subdomain 'www' rather than the root domain. Despite this, the business legitimacy is supported by consistent branding, accreditations, and detailed contact information. Overall, the site scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility. Recommendations include implementing comprehensive security headers, publishing a security policy and incident response contacts, and adding a security.txt file to facilitate vulnerability disclosures. These steps would enhance the security posture and trustworthiness further.

65
20
60
47
53
15
17
lawfirmsolicitorslegalserviceseastangliafamilylaw+5 more
WordPress 7.0Yoast SEO pluginGoogle AnalyticsGoogle Tag Manager+3

Partner Domains:

www.eastmediation.co.uk
partner
unity.online
partner
2026-07-02T07:19:51.531Z
ethitec.com favicon

Ethical Technology Ltd t/a Ethitec

ethitec.com

69
HealthcareUnited KingdomsmallMEDIUM

Ethitec, trading as Ethical Technology Ltd, is a UK-based software company established in 1975 specializing in healthcare and public sector software solutions. Their flagship products include ELMS2, a community equipment management system, and Tiara9, a clinical management system widely used by NHS and allied health professionals. The company positions itself as a trusted provider with a strong focus on quality, evidenced by ISO 9001:2015 and Cyber Essentials Plus certifications. Their target audience includes public sector organizations, healthcare providers, and private sector clients requiring bespoke software solutions. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and uses Google Analytics and reCAPTCHA for tracking and security. The site is mobile-optimized with good navigation and content quality. However, some security best practices like security headers are missing, and WHOIS data for the domain is unavailable, which slightly reduces transparency. Security posture is solid with HTTPS enforced, privacy and cookie consent mechanisms in place, and certifications that indicate a mature security approach. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is good with GDPR-aligned policies and consent management. Business credibility is high due to clear contact information, certifications, and professional content. Overall, Ethitec presents a professional and trustworthy online presence with room for improvement in domain transparency and security headers. Strategic recommendations include publishing security headers, adding incident response contacts, and maintaining up-to-date software to enhance security and trust.

37
80
100
85
70
65
47
healthcaresoftwarenhsclinicalmanagementcommunityequipment+2 more
WordPress 5.7.15jQuery 3.5.1BootstrapGoogle Analytics+3

Partner Domains:

8foldgovernance.com
partner
2026-07-02T07:15:20.678Z
welcom.co.uk favicon

Welcom Digital Limited

welcom.co.uk

70
FinanceUnited KingdommediumMEDIUM

Welcom Digital Limited is a UK-based company specializing in digital lending solutions, primarily through their flagship Financier loan management platform. They serve a broad range of clients including smaller firms and FTSE100 companies, positioning themselves as a trusted provider in the fintech and financial services sectors. Their platform supports consumer, commercial, and secured finance lending with a focus on automation, compliance, and customer experience. The website reflects a professional and consistent brand image with clear navigation and relevant content targeting digital lenders and fintech businesses. Technically, the website employs modern web technologies including Bootstrap, jQuery, Font Awesome, and Google Fonts, with integrations for Google Analytics, Cookiebot for consent management, and Lead Forensics for visitor tracking. The site is mobile-optimized and uses HTTPS with strong SSL configuration. Forms are protected with Google reCAPTCHA and anti-CSRF tokens, indicating attention to security best practices. However, some security headers are not explicitly detected, and no dedicated security or incident response pages are present. The security posture is solid with no visible vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with a comprehensive privacy and cookie policy, GDPR compliance indicators, and a consent mechanism. Business credibility is supported by clear company information, client testimonials, and social media presence. Overall, the website is trustworthy and professionally maintained. Strategically, Welcom Digital should consider publishing explicit security and incident response policies to enhance transparency and trust. Regular security audits and accessibility improvements would further strengthen their digital maturity and compliance posture.

83
40
25
70
85
100
72
loanmanagementsoftwaredigitallendingplatformfintechconsumerfinancecommerciallending+2 more
BootstrapjQueryFont AwesomeGoogle Fonts (Nunito)+5
2026-07-01T07:24:38.427Z
pozen.com favicon

Atom

pozen.com

70
OtherN/asmallMEDIUM

Atom operates a premium domain marketplace, exemplified by the Pozen.com listing, offering verified premium domains for sale with flexible payment options. The website targets businesses and entrepreneurs seeking unique, memorable domain names to establish or enhance their brand presence. Atom positions itself as a professional and trustworthy platform in the premium domain sales market, emphasizing transaction support and installment payments to facilitate purchases. Technically, the website employs modern web technologies including Google Tag Manager, Google reCAPTCHA, and New Relic for performance monitoring. The use of Google Fonts and responsive design elements indicates a commitment to user experience and accessibility. While the site loads efficiently and is mobile-optimized, explicit security headers and privacy policies are not evident, suggesting areas for improvement in compliance and security transparency. From a security perspective, the site enforces HTTPS and integrates bot protection via reCAPTCHA, contributing to a solid baseline security posture. However, the absence of visible privacy and cookie policies, lack of contact information for incident response, and missing WHOIS registrant data reduce overall trust and compliance scores. No critical vulnerabilities or suspicious activities were detected in the accessible content. Overall, Atom's website demonstrates a professional and functional platform for premium domain sales but would benefit from enhanced transparency in privacy, security policies, and contact information to improve trustworthiness and regulatory compliance.

80
73
2
100
42
85
100
premiumdomaindomainsalese-commercebusinesstechnology
Google Tag ManagerGoogle reCAPTCHANew Relic Browser monitoringGoogle Fonts (DM Sans, Plus Jakarta Sans)+1
2026-07-01T07:15:55.763Z
westsussexmusic.co.uk favicon

West Sussex Music

westsussexmusic.co.uk

59
EducationUnited KingdommediumMEDIUM

West Sussex Music is a well-established regional organization dedicated to providing high-quality and inclusive music education and performance opportunities to children and young people across West Sussex. The website reflects a professional and comprehensive service offering, including instrumental and vocal lessons, group ensembles, community projects, and instrument hire. The organization serves a large audience, reaching over 34,000 children annually, positioning itself as a key player in the local educational sector. Technically, the website is built on a modern WordPress CMS platform with popular plugins such as WooCommerce, Yoast SEO, and Events Calendar Pro, indicating a mature digital infrastructure. The site is mobile-optimized, accessible, and SEO-friendly, with good performance and user experience. Security measures include HTTPS enforcement, Google reCAPTCHA integration, and cookie consent mechanisms, demonstrating awareness of privacy and security best practices. The security posture is solid with no detected vulnerabilities or exposed sensitive data. However, the absence of explicit security policies or incident response information suggests room for improvement in formalizing security governance. The WHOIS lookup failed due to domain naming rules, but this does not detract from the website's legitimacy given its professional content and consistent branding. Overall, West Sussex Music presents a trustworthy and credible online presence with strong business and technical foundations. Strategic recommendations include enhancing security policies, publishing incident response and vulnerability disclosure information, and verifying WHOIS registration details to improve transparency and trust.

47
70
100
85
2
15
73
musiceducationeducationchildrenyouthnon-profit+4 more
WordPressWooCommerceYoast SEOjQuery+3
2026-07-01T07:08:12.591Z
sebden.com favicon

Sebden Steel

sebden.com

49
ManufacturingUnited KingdomlargeHIGH

Sebden Steel is a large, privately owned steel processing and stockholding company operating across the UK and Ireland. They position themselves as the largest mill-independent steel processor in the region, offering a wide range of steel products and supply chain services from multiple strategic locations. Their business model focuses on supply chain innovation, product development, and long-term customer partnerships, targeting industrial and manufacturing sectors. The website reflects a professional and consistent brand image with clear business messaging and a strong social media presence. Technically, the website is built on WordPress with modern technologies including jQuery, Font Awesome, and Google reCAPTCHA for form security. SEO is enhanced by Yoast SEO plugin, and analytics are implemented via WP Statistics and Google Analytics. The site is mobile optimized and performs moderately well, though accessibility features are basic. Security posture is good with HTTPS enforced and CAPTCHA protection, but lacks some security headers and explicit security policies. From a security perspective, the site shows no signs of blocking or WAF interference, and no critical vulnerabilities were detected in the content or scripts. However, the absence of privacy and cookie policies indicates compliance gaps, especially regarding GDPR. The WHOIS data is missing or unavailable, which raises concerns about domain registration transparency and trustworthiness, although the website content and business information appear legitimate. Overall, the site is professional and business-focused with a solid technical foundation but would benefit from enhanced privacy compliance and improved domain registration transparency to strengthen trust and security posture.

20
47
80
98
35
17
15
steelmanufacturingservicecentresukireland+3 more
WordPressPHPjQueryFont Awesome+2

Partner Domains:

sebdengroup.com
parent
2026-07-01T07:05:53.890Z
mdchamber.org favicon

Maryland Chamber of Commerce

mdchamber.org

57
OtherUnited StatesmediumMEDIUM

The Maryland Chamber of Commerce is a statewide business advocacy organization focused on partnering with businesses, organizations, policymakers, and communities to promote pro-business policies and economic growth within Maryland. The website reflects a professional and consistent brand presence, targeting businesses and stakeholders in the Maryland region. The organization appears to be established since at least 2016, with a medium-sized operational scale. Technically, the website is built on WordPress, leveraging modern SEO tools such as Yoast SEO Premium, and integrates analytics services including Google Analytics and Facebook Pixel. The site is hosted on Azure CDN infrastructure, ensuring moderate performance and good mobile optimization. Accessibility features are basic but present, and SEO optimization is good with proper metadata and structured data. From a security perspective, the site uses HTTPS with a strong SSL configuration and includes Google reCAPTCHA to protect forms. However, no explicit security headers were detected, and there is a lack of published privacy, cookie, or incident response policies, which are areas for improvement. No vulnerabilities or exposed sensitive data were found in the analyzed content. Overall, the website is trustworthy and professional, with a solid business credibility score. The absence of WHOIS data limits domain registration insights, but the privacy protection is typical for such organizations. Strategic recommendations include enhancing privacy compliance documentation, implementing security headers, and publishing clear contact and incident response information to strengthen trust and security posture.

70
62
100
80
2
35
30
businessadvocacymarylandcommerceeconomicgrowth+1 more
WordPressYoast SEO PremiumFoundation IconsFontAwesome 5.15.4+4
2026-06-30T07:13:44.515Z
howladerandco.com favicon

Howlader & Co

howladerandco.com

48
FinanceUnited KingdomsmallHIGH

Howlader & Co is a well-established chartered accountancy firm based in London, offering a comprehensive range of accounting and tax advisory services tailored to businesses of all sizes, including startups and small enterprises. With over 50 years of combined experience, the firm positions itself as a trusted partner for London businesses seeking expert financial guidance and tax efficiency. Their market position is reinforced by strong trust indicators such as professional certifications (ACCA, ICAEW, Xero Silver Partner) and excellent client reviews. The website reflects a professional and consistent brand image with clear service offerings and contact information. Technically, the website is built on WordPress using modern frameworks like Foundation and includes popular libraries such as jQuery and Owl Carousel. It integrates Google Analytics and Tag Manager for tracking and employs Google reCAPTCHA for form security. The site is mobile-optimized and SEO-friendly, though performance is moderate. Cookie consent is implemented with user customization options, indicating attention to privacy compliance, although no explicit privacy policy or terms of service pages were found. From a security perspective, the site uses HTTPS with good SSL configuration and includes some security best practices like CAPTCHA and consent banners. However, it lacks visible security headers and formal security or incident response policies. The WHOIS data is consistent with the business claims, showing a long-standing domain registration with a reputable UK registrar, supporting the legitimacy of the entity. Overall, Howlader & Co presents a credible, professional online presence with solid business credibility and moderate technical and security maturity. Enhancements in formal privacy documentation, security headers, and incident response disclosures would further strengthen their security posture and compliance standing.

47
70
80
20
30
17
35
accountingcharteredaccountantstaxadvisorylondonfinance+1 more
WordPressjQueryFoundation CSS frameworkOwl Carousel+5
2026-06-30T07:11:53.292Z
W

Wilson Defraine

wilsondefraine.co.uk

41
Real EstateUnited KingdomsmallHIGH

Wilson Defraine is a local family-run estate agency based in Newcastle upon Tyne, specializing in property sales, lettings, valuations, and maintenance services. With over 17 years of experience, the company targets buyers, sellers, landlords, and tenants in the local area, emphasizing personalized customer service and local market knowledge. The website reflects a professional and trustworthy business with clear contact information and multiple client testimonials. Technically, the website employs a modern frontend stack including Bootstrap, jQuery, Google Fonts, and integrates Google reCAPTCHA for form security. It is built on the 10ninety CMS platform and shows good mobile optimization and user experience. However, the site lacks some advanced security headers and explicit cookie consent mechanisms, which are areas for improvement. From a security perspective, the site uses HTTPS and includes anti-bot measures but does not present comprehensive security headers or detailed privacy compliance features. The WHOIS data for the domain is unavailable due to a registration error, which raises some concerns about domain legitimacy, though the website content and business information appear consistent and professional. Overall, the website is functional, professional, and trustworthy but would benefit from enhanced security practices and clearer privacy compliance to improve user trust and regulatory adherence.

47
55
20
65
15
2
53
realestateestateagentpropertysalespropertylettingsvaluation+3 more
BootstrapjQueryGoogle FontsFontello+3
2026-06-30T07:11:10.889Z
batesconcrete.co.uk favicon

Mark Bates & Sons Ltd

batesconcrete.co.uk

45
ManufacturingUnited KingdomsmallHIGH

Mark Bates & Sons Ltd is a small, independent family-run business specializing in the supply of ready mix concrete primarily serving the North West of England, including Manchester, Waterfoot, and Westhoughton. The company emphasizes punctual delivery, quality products, and customer service, supported by BSI and ISO certifications. Their market position is that of a trusted local supplier with over 20 years of operational history. The website reflects a professional and consistent brand image with clear business information and multiple branch locations. Technically, the website is built on WordPress with the UIkit framework, leveraging modern JavaScript libraries and Google services such as Tag Manager and reCAPTCHA. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and security headers implementation. SEO practices are adequately addressed with proper metadata and structured data. From a security perspective, the site uses HTTPS and includes reCAPTCHA for form protection, but lacks visible security headers and explicit privacy or cookie policies, which are important for GDPR compliance. No vulnerabilities or exposed sensitive data were detected in the HTML content. The WHOIS data query failed due to an invalid query on the subdomain, but the website's business legitimacy is supported by company registration details and certifications. Overall, the website presents a low risk profile with good business credibility and moderate technical maturity. Strategic improvements in privacy compliance, security headers, and incident response transparency would enhance the security posture and regulatory adherence.

15
35
7
70
27
30
100
concretereadymixconcretemanchesterconstructionbsicertified+1 more
WordPress 6.1.10jQueryUIkit frameworkGoogle Tag Manager+1
2026-06-30T07:03:35.796Z
glugglugglug.com favicon

Office Watercoolers

glugglugglug.com

65
OtherUnited KingdommediumMEDIUM

Office Watercoolers is a UK-based company specializing in providing and servicing high quality bottled water and mains fed dispensers nationwide. With over 25 years of industry experience and established since 2001, it operates as part of the South Staffordshire Plc group, which includes multiple subsidiaries in water supply and related services. The company targets business customers seeking reliable hydration solutions for offices and commercial environments. Technically, the website is built on WordPress with modern plugins such as Gravity Forms and Yoast SEO, and employs Google Tag Manager and reCAPTCHA for analytics and security. The site is well-structured, mobile-optimized, and includes a comprehensive cookie consent mechanism, reflecting good digital maturity. Security posture is solid with HTTPS enforced and bot protection via reCAPTCHA, though security headers and explicit incident response policies are absent. The lack of WHOIS data reduces domain trustworthiness, but the professional presentation and corporate group affiliation mitigate concerns. Overall, the website is functional, secure, and compliant with basic privacy standards, but could improve transparency and security documentation.

70
93
52
100
17
30
83
watercoolersofficewaterbottledwatermainsfedwatercoolerswaterboilers+4 more
WordPressGravity FormsYoast SEOGoogle Tag Manager+2

Partner Domains:

www.south-staffordshire.com
parent
www.south-staffs-water.co.uk
subsidiary

+3 more partners

2026-06-30T07:02:21.379Z
P

Polyflex Packaging Ltd

polyflexpackaging.co.uk

57
ManufacturingUnited KingdomsmallMEDIUM

Polyflex Packaging Ltd is a UK-based manufacturer specializing in eco-friendly, bespoke flexible packaging solutions tailored for businesses. Established in 1987, the company has a strong market position as a provider of sustainable packaging products including clip close handle bags, duvet and pillow bags, mailing bags, and bale bags. Their manufacturing operations are based in Runcorn Cheshire, with typical lead times of 2-4 weeks. The website reflects a professional and consistent brand image, targeting businesses seeking sustainable packaging options. Technically, the website is built on the GoDaddy Website Builder platform, utilizing modern web technologies such as HTML5, CSS3, and JavaScript. It incorporates Google reCAPTCHA for spam protection and displays a TrustedSite certification badge, indicating a focus on trust and security. The site is mobile-optimized with good SEO and accessibility basics, though some advanced security headers are not explicitly detected. From a security perspective, the site uses HTTPS with good SSL configuration and employs reCAPTCHA on its contact form. However, explicit security policies, incident response contacts, and vulnerability disclosure mechanisms are absent. Cookie consent is implemented with clear accept and decline options, supporting basic privacy compliance. The WHOIS data shows a long-established domain consistent with the business history, enhancing legitimacy. Overall, the website presents a low-risk profile with good business credibility and technical implementation. Strategic recommendations include enhancing security headers, publishing detailed security and incident response policies, and considering a vulnerability disclosure program to further strengthen trust and compliance.

57
100
45
60
45
68
2
packagingsustainableflexiblepackagingcustompackagingukmanufacturer
HTML5CSS3JavaScriptGoogle reCAPTCHA+2
2026-06-29T07:26:11.526Z
T

Testrade Limited

testrade.co.uk

54
ManufacturingUnited KingdomsmallMEDIUM

Testrade Limited is a UK-based specialist supplier of Non-Destructive Testing (NDT) equipment, operating since 1971. The company offers a wide range of high-quality NDT products including magnetic particle inspection, radiography, ultrasonic testing, and related accessories. Their business model focuses on B2B e-commerce with next day delivery on stock items and sourcing specialist products globally. The website reflects a well-established market position within the manufacturing sector, targeting industrial clients requiring reliable NDT solutions. Technically, the website is built on the ShopWired e-commerce platform, utilizing modern JavaScript libraries such as jQuery, Owl Carousel, and PrettyPhoto. It employs HTTPS with Google reCAPTCHA for form security and a cookie consent mechanism, indicating a moderate level of digital maturity. Performance and mobile optimization are good, though accessibility features are basic. SEO practices are adequately implemented with proper meta tags and structured navigation. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms. However, it lacks explicit security headers and published security policies or incident response contacts. No security.txt or vulnerability disclosure information is available, which could be improved to enhance trust and compliance. The WHOIS data for the domain is unavailable due to a naming rules violation error, limiting domain legitimacy verification. Despite this, the website content and business information appear consistent and professional. Overall, the website presents a trustworthy and professional front for Testrade Limited, with good content quality and business credibility. Security posture is adequate but could benefit from additional hardening and transparency. The lack of WHOIS data is a concern but does not currently undermine the business legitimacy based on available information.

65
37
55
100
2
53
45
ndtnondestructivetestingindustrialequipmente-commerceukbusiness+1 more
jQueryOwl CarouselPrettyPhotoGoogle reCAPTCHA+1
2026-06-29T07:24:04.722Z
platingbarrels.com favicon

Eagle Engineering (Telford) Ltd

platingbarrels.com

60
ManufacturingUnited KingdomsmallMEDIUM

Eagle Engineering (Telford) Ltd is a UK-based specialist manufacturer and supplier of high-quality electro-plating barrels, plating barrel units, and related equipment. With over 20 years of industry experience, the company serves a global industrial electroplating market, emphasizing innovative design and durable materials. Their business model focuses on B2B manufacturing and equipment supply, supported by ISO 9001 certification and positive customer testimonials. The website reflects a professional and consistent brand presence, targeting industrial clients worldwide. Technically, the website is built on WordPress using the Divi theme, incorporating common plugins such as Contact Form 7, Formidable Forms, and Google Analytics for tracking. The site is moderately performant, mobile-optimized, and SEO-friendly with structured data and meta tags. Security measures include HTTPS enforcement, Google reCAPTCHA on forms, and cookie consent mechanisms, though additional security headers and explicit security policies could enhance the posture. The security posture is solid with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, GDPR consent, and secure data collection forms. The WHOIS data confirms domain legitimacy with consistent registration details and appropriate domain age matching the business history. Overall, the website presents a trustworthy, professional, and compliant digital presence for Eagle Engineering, with recommendations to strengthen security headers and incident response transparency to further improve risk management.

70
57
100
70
17
15
65
manufacturingplatingbarrelselectroplatingindustrialequipmentiso9001+2 more
WordPressDivi ThemejQueryGoogle Analytics+5
2026-06-29T07:20:32.996Z