Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 503 of 656|Showing 25101-25150 of 32765
davenportslaw.co.nz favicon

Davenports Law

davenportslaw.co.nz

53
Real EstateNew ZealandmediumMEDIUM

Davenports Law is a professional law firm based in North Shore Auckland, New Zealand, specializing in Trust Law, Wills and Estate Law, Commercial Law, and Property Law. The firm targets individuals and businesses seeking tailored legal advice and ongoing support. Their website reflects a well-established regional presence with a medium-sized team and a strong focus on client collaboration and guidance. The site features detailed legal articles, team profiles, testimonials, and affiliations with reputable legal organizations, reinforcing their credibility. Technically, the website employs modern JavaScript libraries such as jQuery, Slick Carousel, and integrates Google Tag Manager, Google Analytics, Facebook Pixel, and LinkedIn Insight Tag for analytics and marketing. The site is mobile-optimized with good SEO practices and a professional design, though some accessibility features are basic. Security-wise, the site uses HTTPS and Google reCAPTCHA for form protection but lacks several recommended security headers, which could be improved to enhance defense against common web attacks. The WHOIS data for the domain is unavailable, which raises some concerns about domain registration transparency. However, the website content and professional presentation strongly suggest legitimacy. No signs of malware or phishing were detected. Privacy policy is present and comprehensive, but no cookie consent mechanism was found despite tracking technologies in use. Overall, the site presents a low risk but would benefit from enhanced security headers and clearer cookie consent to improve compliance and trust. Strategic recommendations include implementing additional security headers, establishing a cookie consent mechanism, and verifying domain registration details to improve trustworthiness and compliance.

35
53
17
80
72
70
20
lawlegaladvicetrustlawpropertylawcommerciallaw+3 more
jQueryjQuery UISlick CarouselGoogle Tag Manager+4
2025-07-07T06:41:56.569Z
thebrandery.co.nz favicon

The Brandery

thebrandery.co.nz

60
OtherNew ZealandsmallMEDIUM

The Brandery is a small creative agency based in Auckland, New Zealand, specializing in graphic design, video production, animation, website design, and branding services. The company targets marketers and businesses across New Zealand and Australia, offering outsourced creative production to help clients regain workday efficiency. The website presents a professional image with a clear portfolio and client logos, indicating a solid market position among startups and industry leaders. Technically, the site is built on Squarespace, leveraging modern web technologies and integrating Google Analytics and Tag Manager for tracking. While the site is mobile-optimized and performs moderately well, there is room for improvement in accessibility and SEO. Security posture is adequate with HTTPS enforced, but lacks advanced security headers such as HSTS and CSP, which are recommended to enhance protection. Privacy compliance is basic, with no visible cookie consent mechanisms or comprehensive GDPR indicators. The absence of WHOIS data is a concern, reducing domain trustworthiness, though the website content suggests legitimacy. Overall, the site scores well in business credibility and content quality but should address security and privacy gaps to improve trust and compliance.

35
53
2
85
62
65
100
creativeagencybrandinggraphicdesignvideoproductionanimation+2 more
SquarespaceGoogle AnalyticsGoogle Tag ManagerTypekit Fonts+1
2025-07-07T06:40:51.452Z
appropo.io favicon

Appropo Limited

appropo.io

58
HospitalityNew ZealandsmallMEDIUM

Appropo Limited operates a specialized SaaS platform focused on the hospitality sector in New Zealand, offering online ordering, payments, loyalty programs, and customer segmentation tools. The company has an established market presence since 2014, serving over 200 cafes, bars, and restaurants. Their platform integrates with notable partners such as DoorDash, Mailchimp, Windcave, and Xero, enhancing their service ecosystem. The website reflects a professional and consistent brand image with good content quality and user experience tailored for hospitality businesses. Technically, the website employs modern web technologies including Alpine.js for interactivity and Google Analytics for user tracking. Hosting appears to be on AWS infrastructure, with DNS managed via AWS nameservers. The site is mobile optimized and SEO friendly, though accessibility features are basic. Security posture is adequate with HTTPS enforced and domain transfer protections in place, but lacks DNSSEC and security headers, which are recommended for enhanced protection. From a security and compliance perspective, the site lacks explicit privacy cookie consent mechanisms and terms of service documentation, which are important for GDPR and general privacy compliance. No incident response or vulnerability disclosure policies are publicly available. The WHOIS data is consistent with the business claims, showing a legitimate and stable domain registration. Overall, the risk profile is moderate with room for improvement in privacy compliance and security hardening. Strategically, Appropo should prioritize implementing cookie consent, publishing clear terms and security policies, enabling DNSSEC, and adding security headers to strengthen trust and compliance. These steps will enhance their security posture and align with regulatory expectations, supporting continued growth in the competitive hospitality technology market.

15
53
2
75
67
75
100
engagementanalyticscustomerloyaltybrand+5 more
HTML5CSS3JavaScriptGoogle Analytics+1

Partner Domains:

vouchers.appropo.io
service
mailchimp.com
partner

+3 more partners

2025-07-07T06:39:46.339Z
britishfires.com.au favicon

British Fires Australia & New Zealand

britishfires.com.au

48
RetailAustraliamediumHIGH

British Fires Australia & New Zealand is a retail business specializing in fireplace products, serving the Australian and New Zealand markets. The company has an established online presence with a domain registered since 2000, indicating long-term market participation. The website uses WordPress CMS with the Divi theme and integrates common marketing and analytics tools such as Google Analytics and Facebook Pixel. The site is professionally designed with good content quality and mobile optimization, targeting general consumers interested in home heating and fireplace products. However, the website lacks explicit privacy and cookie policies, which impacts its privacy compliance score. From a technical perspective, the website employs modern web technologies and is hosted likely on SiteGround, with moderate performance and good SEO optimization. Security posture is adequate with HTTPS enabled, but the absence of security headers and DNSSEC reduces the overall security score. No forms or contact information were detected in the provided content, limiting direct user engagement channels. The security evaluation shows no critical vulnerabilities or WAF blocking, but improvements are recommended in implementing security headers, privacy policies, and cookie consent mechanisms to enhance compliance and trust. The domain registration data aligns well with the website's business claims, supporting legitimacy and trustworthiness. Overall, British Fires Australia & New Zealand presents a credible and professional online presence with room for improvement in privacy compliance and security best practices to strengthen user trust and regulatory adherence.

15
53
2
85
72
75
-
fireplaceretailaustralianewzealandhomeheating+3 more
jQueryGoogle AnalyticsFacebook PixelWeglot+3
2025-07-07T06:39:21.290Z
glaifa-lichtreclame.com favicon

Glaifa Lichtreclame

glaifa-lichtreclame.com

49
RetailNetherlandsmediumHIGH

Glaifa Lichtreclame is a well-established Dutch company specializing in the production and installation of light advertising, facade signage, and related products for businesses. With over 75 years of experience and recognized certifications such as installQ and membership in Techniek Nederland, Glaifa positions itself as a trusted partner for companies seeking high-quality signage solutions. Their website reflects a professional and comprehensive digital presence, offering detailed service descriptions, project showcases, and multiple contact channels including forms protected by Google reCAPTCHA. Technically, the website employs modern web technologies including Mapbox for mapping, Google Tag Manager, Google Analytics, Microsoft Clarity, Hotjar, and ClickCease for analytics and security. The site is mobile-optimized with good SEO practices and a clean, consistent design. Security measures include HTTPS enforcement and spam protection on forms, though explicit security headers are not detected, indicating room for improvement. From a security and compliance perspective, the site maintains privacy and cookie policies with consent mechanisms, aligning with GDPR requirements. However, the lack of WHOIS data for the domain raises questions about domain registration transparency, though the professional nature of the site and presence of valid contact information mitigate immediate concerns. No critical vulnerabilities or adult content are present, and the site is safe for general audiences. Overall, Glaifa Lichtreclame demonstrates a strong business and technical foundation with minor areas for security enhancement and domain registration verification. Strategic recommendations include implementing security headers, clarifying domain registration status, and maintaining rigorous third-party script audits to ensure ongoing security and compliance.

20
68
2
60
72
70
20
lichtreclamegevelreclamegevellettersreclamezuilenlichtbakken+4 more
Mapbox GL JSGoogle Tag ManagerGoogle AnalyticsMicrosoft Clarity+4

Partner Domains:

publima.be
partner
2025-07-07T05:36:42.910Z
F

Federal Reserve Bank of St. Louis

stlouisfed.org

53
GovernmentUnited StateslargeMEDIUM

The Federal Reserve Bank of St. Louis operates as one of the 12 regional Reserve Banks within the Federal Reserve System, serving a critical role in the U.S. central banking framework. The website provides extensive economic resources, data tools, research publications, and educational materials targeted at economists, financial institutions, educators, and the general public. It maintains a strong market position as an authoritative source for economic data and Federal Reserve information. Technically, the website employs a modern technology stack including Bootstrap 4, jQuery, Google Tag Manager, and analytics tools such as Google Analytics and Crazy Egg. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate with room for optimization. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes several security best practices. While some security headers are not explicitly detected, the overall posture is strong with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms and GDPR compliance. Overall, the website is highly professional, trustworthy, and aligned with the Federal Reserve's mission. The lack of WHOIS data is mitigated by the authoritative content and branding. The site poses low risk and serves as a reliable resource for its audience.

-
58
25
70
-
85
100
federalreserveeconomicdatabankingresearcheducation+1 more
jQuery 3.7.1Bootstrap 4Google Tag ManagerGoogle Analytics+3

Partner Domains:

fred.stlouisfed.org
partner
fraser.stlouisfed.org
partner

+2 more partners

2025-07-07T05:34:17.366Z
C

Cities for Financial Empowerment Fund

cfefund.org

60
GovernmentUnited StatesmediumMEDIUM

Cities for Financial Empowerment Fund (CFE Fund) is a US-based non-profit organization founded in 2011 that supports mayors and local governments across the country by providing grant funding and strategic assistance to embed financial empowerment initiatives in municipal operations. The organization has a strong market position with partnerships in approximately 145 cities, directly supporting over 900,000 residents. Their key services include grant distribution, program development, and impact reporting focused on improving financial stability for city residents. Technically, the website is built on WordPress with a modern tech stack including Gravity Forms for data collection, Google Analytics for tracking, and Cloudflare for DNS management. The site demonstrates good mobile optimization, accessibility, and SEO practices, though performance is moderate. The infrastructure is typical for a mid-sized non-profit organization. From a security perspective, the site uses HTTPS and CAPTCHA on forms, but lacks DNSSEC and explicit security headers, which are recommended for enhanced protection. No exposed sensitive data or vulnerabilities were detected in the HTML content. Privacy compliance is basic, with a privacy policy and terms of service present but no cookie consent mechanism. Contact information is available, but no dedicated security policy or incident response contacts were found. Overall, the website is professional, trustworthy, and safe for general audiences. The security posture is adequate but could be improved with additional DNS and header configurations. The organization’s domain registration is privacy protected, consistent with non-profit practices, and the domain age aligns with the organization's history.

30
53
17
60
75
65
100
non-profitfinancialempowermentgovernmentcitiesgrants+1 more
WordPressGravity FormsGoogle AnalyticsCloudflare DNS+6
2025-07-07T05:34:12.358Z
lexology.com favicon

Law Business Research

lexology.com

70
MediaN/alargeMEDIUM

Lexology is a leading global platform delivering comprehensive international legal updates, analysis, and insights primarily targeted at law firms and in-house counsel. The platform offers a wide range of services including legal newsfeeds, research hubs, compliance calendars, masterclasses, and analytics tools, positioning itself as a key resource in the legal media sector. The website is professionally designed with consistent branding and good content quality, supporting its market position as a trusted legal intelligence provider. Technically, Lexology employs modern web technologies such as React, Google Analytics, Hotjar, and CookiePro for tracking and consent management, ensuring a mature digital infrastructure. Security posture is strong with HTTPS enforcement and standard security headers, although explicit security policies and incident response contacts are not publicly disclosed. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The absence of WHOIS data limits full verification of domain legitimacy, but the overall professional presentation and trust signals support a positive risk assessment. Strategic recommendations include publishing security policies, incident response contacts, and enhancing accessibility to further strengthen trust and compliance.

40
95
2
85
75
85
100
legalnewsmediacomplianceanalytics+3 more
ReactjQueryFontAwesomeGoogle Analytics+5
2025-07-07T05:33:47.313Z
bartlit-beck.com favicon

Bartlit Beck LLP

bartlit-beck.com

59
OtherUnited StatesmediumMEDIUM

Bartlit Beck LLP is a nationally recognized boutique law firm specializing in trial practice and corporate transactions. The firm targets corporate clients and individuals requiring high-stakes litigation and corporate legal services. Their business model emphasizes success-based fee arrangements and delivering exceptional client outcomes, supported by numerous industry awards and client testimonials. The website reflects a professional and consistent brand image with comprehensive content tailored to their target audience. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, with custom CSS and JavaScript for user experience enhancements. The site is mobile optimized, accessible, and SEO-friendly, though no CMS or hosting provider details are explicitly identified. Performance is moderate, with good navigation and content structure. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers and formal security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is notably missing or inaccessible, which raises some concerns about domain registration transparency, though the website content and professional presentation strongly indicate legitimacy. Overall, the site scores well on content quality, business credibility, and technical implementation, with room for improvement in security policy transparency and WHOIS data availability.

40
53
2
65
62
70
100
lawfirmlegalservicestrialpracticecorporatetransactionsprofessionalservices
Google AnalyticsGoogle Tag ManagerjQuery (implied by cycle plugin usage)Custom CSS and JS
2025-07-07T05:33:22.269Z
wiley.law favicon

Wiley Rein LLP

wiley.law

69
GovernmentUnited StateslargeMEDIUM

Wiley Rein LLP is a prominent law firm based in Washington, DC, specializing in a broad range of legal fields including Election Law, Environment, Government Contracts, Insurance, Intellectual Property, International Trade, Litigation, Telecom, and White Collar Defense. The firm boasts a large team of 260 attorneys and maintains a strong market position as a leading legal service provider with deep government connections. Their business model focuses on delivering specialized legal and regulatory advice to corporate and government clients. The website reflects a professional and authoritative presence consistent with their market stature. Technically, the website employs modern analytics and tracking technologies such as Google Analytics, Google Tag Manager, Hotjar, and Siteimprove Analytics, combined with a responsive design and good accessibility features. The site is well-structured with clear navigation and optimized for SEO, providing a positive user experience. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms aligned with GDPR compliance. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. No vulnerabilities or exposed sensitive data were found in the HTML content. The WHOIS data is unavailable, likely due to privacy protection, which is justified for a law firm. Overall, the security posture is solid but could be enhanced with additional headers and transparency. The overall risk assessment is low, with the website demonstrating high professionalism, trustworthiness, and compliance. Strategic recommendations include implementing security headers, publishing a security policy, and establishing a vulnerability disclosure process to further strengthen security and trust.

70
68
17
80
52
80
100
lawfirmlegalserviceswashingtondcgovernmentcontractsintellectualproperty+4 more
Google Tag ManagerGoogle AnalyticsHotjarSiteimprove Analytics+1
2025-07-07T05:33:07.224Z
M

Mitchell Silberberg & Knupp LLP

msk.com

56
MediaUnited StateslargeMEDIUM

Mitchell Silberberg & Knupp LLP is a well-established full-service law firm with deep roots in the Los Angeles entertainment industry since 1908. The firm has expanded nationally with offices in Los Angeles, New York, and Washington, D.C., offering a broad range of legal services including intellectual property, litigation, labor and employment, corporate law, immigration, regulatory, tax, and trusts & estates. The website reflects a professional and stable firm culture with a focus on creative legal advisory and business partnership. Technically, the website employs modern web technologies such as HTML5 video, JWPlayer, and integrates Google Analytics and Tag Manager for tracking. The site is moderately optimized for performance and mobile use, with good SEO practices evident in meta tags and structured content. Security posture is adequate with HTTPS implied, but lacks visible security headers and explicit privacy or cookie policies, which are areas for improvement. The absence of WHOIS data raises some concerns about domain registration transparency, though the website content and branding strongly support legitimacy. Overall, the site is professional and trustworthy but would benefit from enhanced privacy compliance and security best practices.

40
35
17
60
42
75
100
lawfirmlegalservicesentertainmentindustryintellectualpropertylitigation+3 more
jwplayer 7.0.0Google Tag ManagerGoogle AnalyticsHTML5 video+2
2025-07-07T05:32:27.159Z
wwhgd.com favicon

Weinberg Wheeler

wwhgd.com

67
OtherUnited StatesmediumMEDIUM

Weinberg, Wheeler, Hudgins, Gunn & Dial, LLC is a national litigation law firm specializing in complex, high-exposure cases, particularly in construction law and catastrophic legal disputes. The firm positions itself as a bold and innovative advocate with extensive trial and arbitration experience across multiple states. Their website reflects a professional and polished digital presence, targeting corporate clients, insurance carriers, and legal professionals seeking expert litigation services. The firm emphasizes its strategic approach and proven track record through client testimonials and detailed service descriptions. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, WebP images for optimized media delivery, and HTML5 video content. The site is mobile-optimized with good accessibility and SEO practices. However, no CMS or hosting provider details are explicitly identified. Performance is moderate with room for improvement in security header implementation. From a security perspective, the site uses HTTPS and has a cookie consent mechanism aligned with privacy regulations, including GDPR compliance. However, no explicit security policies or incident response contacts are published, and security headers are not detected, which could be improved to enhance protection and trust. The absence of WHOIS data for the domain is a notable concern, as it reduces transparency and trustworthiness from a domain registration standpoint. Overall, the website is professional and trustworthy in content and design but would benefit from improved domain registration transparency and enhanced security practices to strengthen its risk posture and compliance stance.

55
68
17
70
72
80
100
lawfirmlitigationconstructionlawtrialadvocacylegalservices+3 more
Google AnalyticsGoogle Tag ManagerSlick CarouselCustom JavaScript+2
2025-07-07T05:32:22.151Z
aalrr.com favicon

Atkinson, Andelson, Loya, Ruud & Romo

aalrr.com

68
OtherUnited StateslargeMEDIUM

Atkinson, Andelson, Loya, Ruud & Romo is a well-established California-based law firm with over 40 years of experience and a large team of over 200 attorneys across nine offices. The firm offers a broad range of legal services including labor and employment law, corporate finance, education law, litigation, and public safety, targeting both public and private sector clients. Their market position is strong within California, supported by awards, client testimonials, and recognized diversity initiatives. Technically, the website employs modern web technologies such as jwplayer for media, Google Analytics and Tag Manager for tracking, and HubSpot for marketing and analytics. The site is well-structured, mobile-optimized, and accessible, with good SEO practices and a comprehensive cookie consent mechanism. However, no CMS or hosting provider details were explicitly identified. From a security perspective, the site enforces HTTPS and provides cookie consent management, but lacks explicit security headers and a published security policy or incident response contacts. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS domain registration data is a notable concern, potentially indicating privacy protection or a registration anomaly, which slightly impacts trustworthiness. Overall, the website is professional, trustworthy, and compliant with privacy regulations, but would benefit from enhanced transparency in domain registration and explicit security policies to improve its security posture and business credibility.

40
83
17
80
62
80
100
legallawfirmcaliforniaattorneysprivacy+4 more
jwplayerGoogle AnalyticsGoogle Tag ManagerHubSpot+2
2025-07-07T05:32:12.136Z
stinson.com favicon

Stinson LLP

stinson.com

68
OtherUnited StateslargeMEDIUM

Stinson LLP is a well-established law firm providing a broad range of legal services to individuals, privately held enterprises, national companies, and international public corporations. The firm emphasizes practical legal guidance, risk minimization, and opportunity realization, supported by a collaborative culture and extensive legal knowledge. Their market position is strong, with multiple office locations across the United States and recognition in legal rankings such as Chambers USA. The website reflects a professional and trustworthy brand with clear navigation and comprehensive content. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, uses web fonts for branding consistency, and implements HTTPS with good security practices. The site is mobile optimized and accessible, with cookie consent mechanisms in place indicating GDPR compliance awareness. However, some advanced security headers are missing, and no explicit security policy or incident response contact information is published. From a security perspective, the site demonstrates a solid posture with HTTPS enforced and secure form handling. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data is notable but does not detract significantly from the site's legitimacy given the professional content and external trust signals. Overall, the site scores well on content quality, technical implementation, security, privacy compliance, and business credibility, making it a reliable and professional online presence for Stinson LLP.

55
68
17
65
72
85
100
lawfirmlegalservicesattorneysprofessionalservicesprivacypolicy+2 more
Google AnalyticsGoogle Tag ManagerWeb fonts (Brandon Grotesque, Freight Text Pro)JavaScript+2

Partner Domains:

paytrace.com
partner
firmseek.com
partner
2025-07-07T05:32:02.121Z
objectrotterdam.com favicon

OBJECT Rotterdam

objectrotterdam.com

59
OtherNetherlandssmallMEDIUM

OBJECT Rotterdam is a niche design fair based in the Netherlands, focusing on contemporary design, art, and fashion. The website serves as a platform to showcase participants, archive past editions, and provide press and contact information. The business targets design professionals, enthusiasts, and media, operating primarily as an event organizer and promoter within the creative industry. The domain has been registered since 2006, consistent with the business's longevity and reputation. Technically, the website is built on WordPress with common plugins and libraries such as jQuery and FontAwesome. It is hosted on a Dutch hosting provider, Hostnet, and employs HTTPS with a good SSL configuration. The site is moderately optimized for performance and mobile devices, with good SEO practices but basic accessibility features. Tracking tools like Google Analytics and Facebook Pixel are used, indicating moderate user tracking. From a security perspective, the site uses HTTPS and has domain transfer protections enabled, but lacks DNSSEC and important security headers. There is no visible privacy or cookie policy, which is a compliance gap. No incident response or vulnerability disclosure information is provided. The site is not blocked by any WAF or security challenge, allowing full content access. Overall, the website is professional and credible but would benefit from enhanced privacy compliance and security hardening. Strategic improvements in these areas would strengthen trust and regulatory adherence.

15
35
2
70
95
80
100
designartexhibitionrotterdamfashion+1 more
WordPress 5.9.10jQuery 3.6.0FontAwesomeGoogle Analytics+1
2025-07-07T05:30:21.689Z
P

Puro.earth Oy

puro.earth

60
EnergyFinlandmediumMEDIUM

Puro.earth Oy operates a leading carbon removal certification platform focused on mobilizing the net-negative economy by certifying carbon removal suppliers and issuing CO2 Removal Certificates (CORCs). The company serves corporate buyers and partners globally, providing a trusted standard and registry for engineered carbon removal. Their business model centers on facilitating transparent and verifiable carbon removal transactions, supported by a robust supplier and buyer network. The website reflects a mature digital presence with clear branding, comprehensive content, and strong market positioning in the energy and sustainability sector. Technically, the site leverages the Odoo CMS platform, integrates multiple analytics and marketing tools including Google Analytics, HubSpot, and Facebook Pixel, and is hosted on Azure DNS infrastructure. The site is mobile-optimized and SEO-friendly, providing a professional user experience. Security posture is solid with HTTPS enforced and domain transfer protections in place, though DNSSEC is not enabled and some security headers are missing. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. No critical vulnerabilities or suspicious content were detected. Overall, Puro.earth demonstrates a credible, professional, and secure online presence aligned with its business objectives.

15
83
2
75
42
75
100
carbonremovalcarboncreditsenvironmentsustainabilityclimate+3 more
Odoo CMSGoogle AnalyticsGoogle Tag ManagerHubSpot Forms and Analytics+2
2025-07-07T05:29:21.572Z
bluestar.co.nz favicon

Blue Star Group (New Zealand) Limited

bluestar.co.nz

70
OtherNew ZealandlargeMEDIUM

Blue Star Group (New Zealand) Limited is a leading print communications company based in New Zealand, specializing in integrated marketing execution services including print, packaging, design, customer communications, merchandise, and logistics. The company positions itself as a pragmatic and agile partner for Kiwi businesses, offering comprehensive solutions to enhance customer engagement. The website reflects a professional and consistent brand image with clear service offerings and a focus on quality and innovation. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and jQuery, supplemented by marketing and analytics tools like HubSpot and Google Analytics. The site is mobile-optimized and demonstrates good SEO practices, though accessibility features could be improved. Performance is moderate, with no critical technical issues detected. From a security perspective, the site employs HTTPS and demonstrates commitment to security best practices, evidenced by ISO/IEC 27001 certification and a cookie consent mechanism. However, security headers are not explicitly detected, and there is no public vulnerability disclosure or incident response contact information. No vulnerabilities or exposed sensitive data were found in the analyzed content. Overall, the website presents a low risk profile with strong business credibility and privacy compliance. The absence of WHOIS data limits domain trust verification but does not detract significantly from the overall assessment. Strategic recommendations include enhancing security headers, publishing incident response contacts, and improving accessibility compliance.

70
68
2
90
72
75
100
printpackagingdesigncommunicationmerchandise+3 more
jQueryBootstrap 4.3.1Slick CarouselFlexslider+2
2025-07-07T04:26:12.806Z
M

Milestone Foundation Limited

milestonefoundation.co.nz

53
Non-profitNew ZealandsmallMEDIUM

Milestone Foundation Limited is a New Zealand-based non-profit organization established in 2015 to support local communities, particularly focusing on education, health, and Asian cultural promotion. The foundation operates under the Gambling Act 2003 and is regulated by the Department of Internal Affairs. Its primary business model involves distributing grants funded by Class 4 Gaming Venues and engaging with local Asian communities. The website serves as an informational and application portal for grants and membership inquiries. Technically, the website is built on the Weebly platform, utilizing legacy jQuery 1.8.3, Google Analytics, and Snowplow for tracking. The site is moderately optimized for mobile devices and has basic SEO and accessibility features. However, it lacks modern security headers and up-to-date libraries, which could pose security risks. From a security perspective, the site uses HTTPS and Google reCAPTCHA for form protection but lacks visible security headers and privacy policies, indicating gaps in compliance and security best practices. The absence of WHOIS data for the domain reduces trustworthiness, although the website content and structure appear legitimate for a small non-profit. Overall, the website presents a moderate risk profile with room for improvement in security posture, privacy compliance, and technical modernization. Strategic recommendations include updating libraries, implementing security headers, publishing privacy and cookie policies, and verifying domain registration details to enhance trust and compliance.

20
35
2
75
62
65
100
non-profitcommunitygrantsasianculturenewzealand+2 more
jQuery 1.8.3Google AnalyticsWeebly platformEditMySite CDN+1

Partner Domains:

milestone.grants.comssystems.cloud
service
mandarin.milestonefoundation.co.nz
service
2025-07-07T04:25:52.771Z
aucklandstadiums.co.nz favicon

Auckland Stadiums

aucklandstadiums.co.nz

70
HospitalityNew ZealandmediumMEDIUM

Auckland Stadiums is New Zealand’s largest stadium provider, managing and promoting major venues including Go Media Stadium Mt Smart, North Harbour Stadium, Western Springs Stadium, and Lilyworld. The organization targets sports fans, concert attendees, and the general public in Auckland and surrounding regions. Their market position is strong as a key player in the hospitality and event management sector, supported by a professional and content-rich website that provides comprehensive event information and visitor resources. Technically, the website is built using modern technologies such as React, Google Analytics, Hotjar, Microsoft Clarity, and Google Tag Manager, indicating a mature digital infrastructure. The site is mobile-optimized, accessible, and SEO-friendly with structured data enhancing search engine visibility. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and uses reCAPTCHA v3 and cookie consent mechanisms, demonstrating good privacy compliance and user protection. However, the absence of explicit security headers and a public security policy or vulnerability disclosure page suggests areas for improvement. The lack of WHOIS data for the domain raises concerns about domain registration legitimacy, though the website content and branding appear professional and trustworthy. Overall, Auckland Stadiums presents a credible and professional online presence with strong business insights and technical implementation. Addressing security header implementation and clarifying domain registration status would enhance trust and security posture.

60
68
17
85
77
70
100
aucklandstadiumseventssportsconcertsgomediastadium+4 more
ReactGoogle AnalyticsGoogle Tag ManagerHotjar+4

Partner Domains:

aucklandunlimited.com
parent
lilyworld.co.nz
subsidiary
2025-07-07T04:24:47.623Z