Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 42 of 1003|Showing 2051-2100 of 50115
B

Barton Fabrications Limited

bartonfabs.co.uk

46
ManufacturingUnited KingdommediumHIGH

Barton Fabrications Limited is a UK-based company specializing in the design, manufacture, installation, and servicing of aluminium and stainless steel bulk storage silos and pressure vessels. Established in 1981, Barton positions itself as a market leader in the UK for technical silos serving industries such as chemicals, plastics, food, and pharmaceuticals. The company offers a comprehensive range of services including bespoke silo design, installation, ATEX refurbishment, and silo modifications. Their website reflects a professional and consistent brand image, targeting industrial clients requiring bulk storage solutions. Technically, the website employs modern front-end technologies including Bootstrap, jQuery, and popular slider and carousel libraries. It is mobile-optimized with good navigation and SEO practices. The presence of multiple Google Analytics and Tag Manager scripts indicates active digital marketing and user behavior tracking. However, the site lacks a cookie consent mechanism, which is a privacy compliance gap. From a security perspective, the site uses HTTPS and does not expose sensitive data in its HTML content. However, no security headers were detected, and there is no published security policy or incident response contact information. The WHOIS lookup failed due to domain naming rules errors, which is unusual and reduces domain trustworthiness. Despite this, the website content and business information appear legitimate and professional. Overall, Barton Fabrications presents a credible industrial business with a well-structured website. Security and privacy compliance can be improved by adding security headers, cookie consent, and incident response details. The WHOIS anomaly should be investigated to ensure domain registration legitimacy and continuity.

15
53
2
85
47
70
20
industrialmanufacturingsilosbulkstoragealuminium+3 more
Bootstrap CSSjQueryRevolution SliderOwl Carousel+2
2026-06-27T07:22:38.932Z
C

Cole Easdon Consultants Limited

coleeasdon.com

52
TransportationUnited KingdommediumMEDIUM

Cole Easdon Consultants Limited is a well-established UK-based independent engineering consultancy specializing in Water Management, Transport Planning, Infrastructure Design, and Expert Witness services. Operating since 1986, the company serves a broad client base including developers, planners, and local authorities, providing comprehensive consultancy from feasibility through to construction. The website reflects a professional and consistent brand image with detailed case studies and client testimonials that reinforce its market position. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Slick Slider, and Google Analytics for tracking. Hosting appears to be managed by WPEngine, ensuring reliable performance and moderate loading speeds. The site is mobile-optimized and SEO-friendly, though accessibility features are basic. Security posture is generally good with HTTPS enforced, but lacks some security headers and a cookie consent mechanism, which are recommended for compliance and enhanced protection. From a security perspective, no blocking or WAF mechanisms were detected, and no vulnerabilities were apparent in the HTML content. However, the absence of WHOIS data for the domain raises concerns about domain registration legitimacy, which should be further investigated. Privacy compliance is partial, with a privacy policy present but no cookie consent banner or detailed data retention disclosures. Overall, the website presents a trustworthy and professional front for the business but would benefit from improved security headers, enhanced privacy compliance, and verification of domain registration details to strengthen trust and reduce risk.

15
53
17
55
37
65
100
engineeringconsultancytransportplanningwatermanagementinfrastructuredesign+3 more
WordPressjQuerySlick SliderGoogle Analytics+2
2026-06-27T07:22:28.376Z
O

Orchid Farmtech

orchidfarmtech.co.uk

47
TechnologyUnited KingdomsmallHIGH

Orchid Farmtech is a UK-based small business specializing in farm computer software and IT support services tailored for livestock farming enterprises including beef, dairy, and sheep management. Established around 2016, the company positions itself as a niche provider helping UK farmers leverage technology for business management and marketing. Their website reflects a professional and consistent brand presence with clear service offerings and certifications such as Microsoft Partner and BCMS approval, enhancing trustworthiness. Technically, the website is built on WordPress using the Weaver Xtreme theme and integrates common technologies like jQuery, MasterSlider, and Google Analytics via MonsterInsights. The site is mobile-optimized with good SEO practices and moderate performance. Security posture is solid with HTTPS enforced and no visible vulnerabilities, though security headers and cookie consent mechanisms are lacking, indicating room for improvement in compliance and defense-in-depth. The security posture is adequate for the business scale, with no detected vulnerabilities or exposed sensitive data. However, the absence of a cookie consent banner and security headers slightly reduces privacy compliance scores. The WHOIS lookup for the domain 'www.orchidfarmtech.co.uk' failed due to naming rules, but the website is accessible and consistent with business claims, suggesting the domain is registered without the 'www' prefix or under a valid variant. Overall, the site demonstrates a trustworthy and professional online presence with minor areas for enhancement in security and privacy compliance.

-
57
55
65
65
53
2
farmsoftwarelivestockmanagementukfarmingitsupportwordpress+1 more
WordPressjQueryMasterSliderGoogle Analytics (MonsterInsights)+2
2026-06-27T07:22:17.778Z
eclipseprocurement.com favicon

Eclipse Procurement Limited

eclipseprocurement.com

45
Real EstateUnited KingdomsmallHIGH

Eclipse Procurement Limited is a UK-based small enterprise specializing in procurement solutions for the construction industry. Founded in 2010, the company offers a comprehensive range of services including strategic procurement, package procurement, supply chain management, system and process development, ISO certification assistance, and specialist recruitment. Their client base includes contractors, developers, and consultants across both public and private sectors in the UK. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress using Elementor and standard web technologies such as jQuery and Bootstrap. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and SEO. Security posture is adequate with HTTPS enabled and domain transfer protections in place, but lacks advanced security headers and published security policies. Privacy compliance is limited due to the absence of a cookie consent mechanism and GDPR indicators. Overall, the website demonstrates a solid business presence with trustworthy indicators such as ISO certifications and a professional leadership team. However, it would benefit from enhanced security practices, privacy compliance improvements, and clearer contact information to strengthen trust and regulatory adherence.

85
20
70
37
15
53
2
procurementconstructionisocertificationsupplychainstrategicprocurement+1 more
WordPressElementorjQueryBootstrap+1
2026-06-27T07:19:20.145Z
M

Macfarlane Concrete Pumping Ltd

macfarlaneconcretepumping.co.uk

42
TransportationUnited KingdomsmallHIGH

Macfarlane Concrete Pumping Ltd is a small, family-run business specializing in mobile truck mounted concrete pump hire across regions including Cheshire, North West, North Wales, Manchester, Liverpool, and the Midlands. Established in 2009 and operating a diverse fleet, the company serves a broad client base including construction firms, local councils, schools, and retail parks. Their market position is that of a regional specialist with professional operators and recognized certifications such as Constructionline Gold and CPA membership. Technically, the website is built on WordPress 7.0, utilizing Bootstrap 4.2.1, jQuery, and FontAwesome, with Google Analytics and Tag Manager for tracking. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Hosting is inferred to be via GoDaddy, consistent with the WHOIS registrar data. From a security perspective, the site uses HTTPS and avoids exposing sensitive data. However, it lacks visible security headers and does not provide a privacy or cookie policy, which are compliance gaps. No incident response or vulnerability disclosure information is present. The security posture is moderate but could be improved with better header implementation and privacy compliance. Overall, the website is professional, trustworthy, and well-aligned with the business's operational scope. The main risks relate to privacy compliance and security best practices, which if addressed, would enhance the site's credibility and user trust.

70
70
47
20
35
2
15
concretepumpingconstructionmobileconcretepumpstruckmountedpumpscheshire+3 more
jQueryBootstrap 4.2.1FontAwesome 5.6.3Google Analytics+3
2026-06-27T07:18:16.501Z
I

Infinigate UK & Ireland Ltd

infinigate.co.uk

64
TechnologyUnited KingdomlargeMEDIUM

Infinigate UK & Ireland Ltd operates as a prominent IT distributor specializing in cybersecurity, secure networks, and cloud solutions. The company enables its partners to grow by collaborating with renowned vendors, positioning itself as a key player in the UK technology distribution market. The website reflects a professional and well-structured digital presence, targeting IT resellers and partners in the cybersecurity and cloud sectors. Technically, the site is built on WordPress with modern tools such as Yoast SEO Premium, Matomo Analytics, and Cookiebot for consent management, indicating a mature digital infrastructure. Security-wise, the website enforces HTTPS, employs bot detection mechanisms, and manages cookie consent effectively, though explicit security headers could be further enhanced. Overall, the site demonstrates a strong security posture with no visible vulnerabilities or exposed sensitive data. The absence of WHOIS data introduces some uncertainty regarding domain registration legitimacy, but the professional branding and consistent content mitigate this concern. Strategic recommendations include enhancing security headers, auditing third-party scripts regularly, and ensuring robust form security to maintain and improve trust and compliance.

70
37
100
70
15
88
47
cybersecurityclouditdistributionpartnerenablementprivacy+2 more
WordPressYoast SEO PremiumjQueryMatomo Analytics+2
2026-06-27T07:16:35.660Z
decorquip.com favicon

Decorquip Limited

decorquip.com

67
RetailUnited KingdommediumMEDIUM

Decorquip Limited is a UK-based, family-owned business specializing in supplying the window furnishing trade with premium made-to-measure blinds, fabrics, components, and workroom supplies. With over 25 years of experience, the company positions itself as a trusted partner for trade professionals, offering a comprehensive product range and tailored services including motorisation and smart home window treatments. The website reflects a mature digital presence with a modern, responsive design and a strong focus on B2B customers such as retailers, designers, and workrooms. Technically, the website employs a robust tech stack including Bootstrap, jQuery, Swiper.js, and Google Analytics, hosted behind Cloudflare. It features advanced user interaction elements such as AJAX login forms, a cookie consent mechanism with granular controls, and live chat integration via PureChat. The site is well-optimized for mobile devices and SEO, with structured data enhancing search engine understanding. From a security perspective, the site enforces HTTPS and anonymizes IPs in analytics, but lacks visible security headers and published security policies or incident response information. The absence of WHOIS registrant data is a notable concern, reducing domain trustworthiness despite the professional website content. Overall, the site demonstrates a good security posture but could improve transparency and technical security controls. The overall risk is moderate; the business appears legitimate and professional, but the missing WHOIS data warrants caution. Strategic recommendations include enhancing security headers, publishing security and incident response policies, and verifying domain registration details to improve trust and compliance.

80
52
85
100
70
68
2
made-to-measureblindswindowshadingsolutionswholesaleblindcomponentsmotorisedblindsrollerblinds+12 more
BootstrapjQuerySwiper.jsFontAwesome+7
2026-06-27T07:15:58.357Z
miller-insurance.com favicon

Miller Insurance

miller-insurance.com

73
FinanceUnited KingdomlargeMEDIUM

Miller Insurance is a leading specialist broking and reinsurance firm operating primarily in the UK and international markets, including Lloyd's. The company offers a broad range of insurance products and services targeting corporate and private clients across multiple sectors such as energy, construction, and transport. Their website reflects a mature digital presence with professional design, clear navigation, and comprehensive content that supports their market position as industry leaders. Technically, the website employs modern JavaScript frameworks, integrates multiple analytics and advertising tools, and implements GDPR-compliant cookie consent mechanisms. The site is mobile-optimized and accessible, with good SEO practices. Security posture is strong with HTTPS enforcement and security headers, though there is room for improvement in publishing explicit security policies and incident response information. The absence of WHOIS data for the domain is a notable anomaly that impacts trustworthiness, suggesting either privacy protection or recent registration. Despite this, the professional presentation and comprehensive business information mitigate some concerns. Overall, the site demonstrates a solid security and compliance posture with minor gaps. Strategic recommendations include publishing a formal security policy, establishing clear incident response contacts, and adding a vulnerability disclosure program to enhance transparency and trust. Regular audits of third-party scripts and continued adherence to privacy regulations will further strengthen their security and compliance standing.

75
88
25
80
52
85
100
insurancereinsurancebrokingcorporateinsuranceprivateclients+3 more
JavaScriptjQueryGoogle Tag ManagerGoogle Analytics+2
2026-06-27T07:13:45.079Z
astrapac.co.uk favicon

Astrapac Midlands Ltd

astrapac.co.uk

45
ManufacturingUnited KingdomsmallHIGH

Astrapac Midlands Ltd is a UK-based manufacturer specializing in heat sealing machines serving industrial, medical, pharmaceutical, and food sectors. With over 45 years of experience and ISO 9001 certification, the company positions itself as a leading provider of heat sealing solutions in the UK market. Their business model focuses on manufacturing, direct sales, and after-sales services including calibration, repairs, and technical support. The website reflects a professional and consistent brand image targeting industrial and medical clients. Technically, the website is built on WordPress with WooCommerce, utilizing common JavaScript libraries such as jQuery and MasterSlider. The site is moderately performant, mobile-optimized, and SEO-friendly, though accessibility features are basic. Tracking is implemented via Google Analytics and WhoIsVisiting, but no cookie consent mechanism is present. From a security perspective, the site enforces HTTPS and uses CAPTCHA on its contact form, but lacks security headers and published security policies. The WHOIS lookup failed due to querying an invalid domain format, which impacts domain registration trust assessment. Overall, the security posture is moderate with room for improvement in headers and privacy compliance. The overall risk is moderate; the business appears legitimate and professional, but domain registration inconsistencies and missing security headers suggest areas for enhancement. Strategic recommendations include implementing security headers, adding cookie consent, publishing incident response policies, and correcting WHOIS domain queries for accurate domain data.

65
60
58
20
2
20
57
manufacturingheatsealersindustrialmedicalpharmaceutical+5 more
jQueryWooCommerceMasterSliderGoogle Analytics+1
2026-06-27T07:13:39.790Z
matthew-homes.com favicon

Matthew Homes

matthew-homes.com

50
Real EstateUnited KingdommediumMEDIUM

Matthew Homes is an established UK-based home builder with a heritage dating back to the 1950s, specializing in residential property developments across London and the South East of England. The company offers a diverse range of homes and aftersales services, positioning itself as a trusted builder with a focus on quality and style. Their website reflects a professional and consistent brand image, targeting home buyers in the UK market. Technically, the website is built on WordPress with a modern tech stack including jQuery, Google Analytics, Google Tag Manager, and Google reCAPTCHA for form security. The site is moderately performant, mobile-optimized, and SEO-friendly, though accessibility features are basic. Hosting and domain registration are stable and transparent, with no privacy protection on WHOIS data, indicating legitimacy. From a security perspective, the site uses HTTPS with a valid SSL configuration and employs reCAPTCHA to protect forms. However, DNSSEC is not enabled, and no explicit security headers were detected, which are areas for improvement. Privacy compliance is partially addressed with a comprehensive privacy policy but lacks a cookie consent mechanism. Contact information is clearly presented, enhancing business credibility. Overall, the website presents a low-risk profile with good business credibility and technical implementation. Strategic improvements in security headers, DNSSEC, and privacy consent mechanisms would enhance the security posture and compliance standing.

44
75
20
75
30
17
53
realestatehomebuildingpropertydevelopmentukconstruction+1 more
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+3
2026-06-27T07:13:23.890Z
ausenco.com favicon

Ausenco

ausenco.com

49
EnergyUnited StateslargeHIGH

Ausenco is a global engineering, consulting, and project delivery firm specializing in the mining, metals, and industrial sectors. With over 30 years of experience and operations in more than 80 countries, Ausenco offers a comprehensive suite of services including consulting studies, project delivery, asset operations, maintenance solutions, and digital innovations such as AI and environmental planning. The company positions itself as a partner to clients, helping navigate complex mining challenges with sustainable and innovative solutions. Technically, the website is built on Craft CMS and leverages modern JavaScript libraries such as jQuery, Flickity for carousels, and Vanilla LazyLoad for performance optimization. It integrates Google Tag Manager and LinkedIn Insight for analytics and marketing. The site is hosted with Amazon Registrar, indicating likely AWS infrastructure. The website demonstrates good mobile optimization, accessibility, and SEO practices, though performance is moderate. From a security perspective, the site enforces HTTPS and has domain transfer protections in place. However, DNSSEC is not enabled, and there is a lack of explicit security headers and a published security policy or incident response contact. Privacy compliance is partially met with a privacy policy present, but no visible cookie consent mechanism or GDPR-specific disclosures. The business credibility is high with clear company information, professional content, and strong trust signals. Overall, Ausenco's website reflects a mature, professional organization with a solid digital presence and good security fundamentals. To enhance trust and compliance, it is recommended to enable DNSSEC, implement security headers, provide explicit cookie consent, and publish security and incident response policies.

57
20
80
85
15
2
53
miningengineeringconsultingprojectdeliveryassetmanagement+2 more
jQueryFlickityVanilla LazyLoadGoogle Tag Manager+2
2026-06-27T07:12:19.880Z
totalperformancedata.com favicon

Total Performance Data

totalperformancedata.com

47
TechnologyN/amediumHIGH

Total Performance Data (TPD) is a specialized data provider focused on delivering live and post-race horse racing data globally. The company leverages advanced GNSS/GPS technology to provide real-time positional and performance data from over 150 racetracks across 15 countries. Their services cater to a diverse audience including racecourses, owners, trainers, bookmakers, punters, and professional gamblers. TPD has established partnerships with prestigious racetracks such as Royal Ascot and Meydan, positioning itself as a global leader in the horse racing data industry. Technically, the website is built on WordPress using modern plugins like Elementor and Yoast SEO, with Google Analytics integrated for visitor tracking. The site is mobile-optimized and presents a professional design with clear navigation. Security-wise, HTTPS is enforced and a cookie consent mechanism is implemented, though explicit security headers are not evident in the HTML source. The absence of WHOIS registration data raises transparency concerns, but the website content and business partnerships support legitimacy. Privacy compliance is partially addressed with cookie consent but lacks a clear privacy policy page. Overall, TPD demonstrates a mature digital presence with room for improvement in transparency and security best practices.

47
20
75
70
65
2
15
horseracingdataproviderlivetrackingbettingsportsdata+2 more
WordPressElementorYoast SEOGoogle Analytics+4

Partner Domains:

tpd.zone
partner
2026-06-27T07:09:50.999Z
3bm.co.uk favicon

Fusion Project Management Ltd

3bm.co.uk

56
Real EstateUnited KingdommediumMEDIUM

3BM Ltd is a UK-based professional services company specializing in property-related consultancy, architecture, planning, project management, and cost consultancy. Established in 2013 and now part of the RSK Group, 3BM serves both public and private sectors with a strong focus on education, government, and real estate projects. The company leverages a skilled workforce and strategic partnerships to deliver innovative and cost-effective solutions. The website reflects a professional and consistent brand image with comprehensive service descriptions and client testimonials, positioning 3BM as a reputable player in its market segment. Technically, the website is built on WordPress with modern plugins such as WPBakery and Yoast SEO, ensuring good SEO and content management capabilities. The site uses HTTPS with a good SSL configuration and includes cookie consent mechanisms aligned with GDPR requirements. While some security headers are not explicitly detected, the overall security posture is solid with no visible vulnerabilities or exposed sensitive data. The security posture is enhanced by the use of reputable plugins and the presence of ISO certifications and professional memberships, which also serve as trust indicators. The site includes clear contact information and social media links, supporting transparency and user engagement. No signs of malicious activity or content safety concerns were found, and the site is fully accessible without WAF or blocking mechanisms. Overall, 3BM's digital presence is professional, secure, and compliant, supporting its business credibility and market positioning. Strategic recommendations include enhancing security headers, maintaining regular updates, and considering publication of a dedicated security or incident response policy to further strengthen trust and compliance.

54
70
85
20
17
40
80
propertyservicesarchitectureprojectmanagementconsultancyeducationsector+2 more
WordPress 6.7.5WPBakery Page BuilderYoast SEOjQuery+2

Partner Domains:

3bmstudio.co.uk
subsidiary
fusion-pm.co.uk
subsidiary

+1 more partners

2026-06-27T07:09:40.332Z
C

Carlsons Solicitors

carlsonssolicitors.com

66
Real EstateUnited KingdomsmallMEDIUM

Carlsons Solicitors is a full-service law firm based in London, serving both national and international clients. The firm is recognized in The Legal 500 UK 2026, indicating a strong market position and reputable service offering. Their key services include family law, residential conveyancing, probate, debt recovery, immigration, and dispute resolution. The website targets individuals and businesses seeking professional legal assistance, emphasizing client relationships and personalized service. Technically, the website is built on the Squarespace platform, leveraging modern web technologies such as Google Analytics, Google Tag Manager, and the Plyr video player. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, typical for a CMS-based site with multimedia content. From a security perspective, the site enforces HTTPS and implements a cookie consent banner, but lacks advanced security headers such as HSTS and Content-Security-Policy. No explicit security or incident response policies are published, which could be improved to enhance trust and compliance. The WHOIS data is unavailable, which reduces transparency and trustworthiness, though the professional content and client testimonials mitigate some concerns. Overall, the website presents a professional and trustworthy image suitable for a law firm, but could benefit from enhanced security practices and clearer privacy documentation to improve compliance and user trust.

80
54
100
75
17
35
95
lawfirmlegalservicesfamilylawconveyancingdisputeresolution+2 more
Squarespace CMSGoogle AnalyticsGoogle Tag ManagerjQuery+2
2026-06-27T07:09:03.204Z
yoma.co.uk favicon

Yoma Digital Ltd

yoma.co.uk

70
E-commerceUnited KingdommediumMEDIUM

Yoma Digital Ltd is a UK-based full-service digital agency specializing in ecommerce development, digital marketing, and ERP integrations, notably as an exclusive Epicor Commerce partner in the UK and Ireland. The company offers a comprehensive suite of services including custom ecommerce stores, SEO, PPC, CRO, content marketing, and hosting solutions tailored to ecommerce businesses. Their market position is strengthened by strategic partnerships with major ecommerce platforms and ERP providers, supported by client testimonials and a professional online presence. Technically, the website is built on WordPress with modern integrations such as Google Tag Manager, Microsoft Clarity, LinkedIn Insight, and reCAPTCHA v3 for security. The site demonstrates good mobile optimization, SEO practices, and accessibility features. Hosting and domain registration are consistent with the company's UK base, though DNSSEC is not enabled. Security posture is solid with HTTPS enforced, secure forms, and cookie consent mechanisms in place. However, there is room for improvement in implementing comprehensive security headers and publishing explicit security policies. No vulnerabilities or exposed sensitive data were detected. Overall, the website presents a trustworthy, professional, and well-structured digital presence with strong business credibility and compliance with privacy regulations. Strategic recommendations include enhancing DNS security, security headers, and formalizing incident response policies to further strengthen security and trust.

47
75
100
85
83
2
80
ecommercedigitalmarketingseoppcmagento+5 more
WordPressPHPjQueryGoogle Tag Manager+4
2026-06-27T07:08:20.574Z
ulyettlandscapes.com favicon

Ulyett Landscapes Ltd

ulyettlandscapes.com

55
Real EstateUnited KingdommediumMEDIUM

Ulyett Landscapes Ltd is a well-established landscaping and grounds maintenance company based in the United Kingdom, founded in 1967. The company serves both commercial and domestic clients, maintaining over 300 sites and offering a wide range of services including tree surgery, artificial grass installation, hard and soft landscaping, fencing, and seasonal services such as gritting and snow clearance. Their market position is strong within the East Midlands region, supported by multiple industry certifications and a solid reputation evidenced by positive customer reviews. The website reflects a professional business model focused on service delivery and client satisfaction. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, Contact Form 7, and Complianz GDPR Cookie Consent, indicating a mature digital infrastructure. The site is mobile-optimized, SEO-friendly, and integrates Google Tag Manager and Facebook Pixel for marketing and analytics purposes. Security measures include HTTPS enforcement and CAPTCHA protection on forms, although some security headers are not explicitly detected and DNSSEC is not enabled, representing areas for improvement. From a security perspective, the website demonstrates good practices with no visible vulnerabilities or exposed sensitive data. Privacy compliance is robust with clear cookie consent mechanisms and a comprehensive privacy policy. However, there is no explicit incident response or vulnerability disclosure information available, which could be enhanced to improve security posture. Overall, the domain registration data aligns well with the business claims, supporting the legitimacy and trustworthiness of the site. The overall risk assessment is low, with the website presenting a professional, secure, and compliant digital presence. Strategic recommendations include implementing additional security headers, enabling DNSSEC, and adding incident response contact details to further strengthen…

100
85
50
-
15
10
95
landscapinggroundsmaintenancetreesurgeryartificialgrasscommerciallandscaping+3 more
WordPressYoast SEOContact Form 7Complianz GDPR Cookie Consent+5
2026-06-27T07:06:39.639Z
romo.com favicon

Romo

romo.com

68
RetailUnited KingdomlargeMEDIUM

Romo is a well-established British company specializing in designer fabrics, upholstery, wallcoverings, and related accessories. Founded in 1902, it operates as part of The Romo Group, which includes several subsidiary brands. The company targets interior designers, retailers, and consumers seeking high-end interior textiles, maintaining a strong international presence with showrooms and distributors worldwide. The website reflects a professional and comprehensive digital presence, showcasing product collections, company information, and multiple contact channels. Technically, the website uses a modern technology stack including JavaScript frameworks, Cloudflare services, and a custom CMS built on Yii PHP framework. It is optimized for mobile devices, includes accessibility features, and employs security best practices such as HTTPS, CSRF tokens, and cookie consent mechanisms. Performance is moderate with good SEO and user experience. Security posture is solid with HTTPS and security headers, but lacks publicly available security policies or incident response information. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with clear privacy and cookie policies and GDPR compliance indicators. Overall, the website is trustworthy and professional, though the absence of WHOIS registration data is a concern that slightly reduces trustworthiness. Strategic recommendations include publishing explicit security policies, incident response contacts, and vulnerability disclosure information to enhance transparency and security maturity.

49
100
87
70
73
2
80
designerfabricsupholsterywallcoveringsinteriortextilesbritishdesign+3 more
JavaScriptjQueryCloudflare StreamModernizr+1

Partner Domains:

www.blackedition.com
partner
www.kirkbydesign.com
partner

+3 more partners

2026-06-27T07:06:13.125Z
silverstonerally.co.uk favicon

Silverstone Rally School

silverstonerally.co.uk

53
TransportationUnited KingdomsmallMEDIUM

Silverstone Rally School is a well-established motorsport training and experience provider based in the United Kingdom, operating since 1998. The company specializes in rally driving experiences, including half-day and full-day courses, adrenaline and off-road challenges, private tuition, junior experiences, and rally car hire. The school is accredited by the British Association of Rally Schools (BARS), offering official rally licenses and expert instruction. Their market position is strong within the niche of rally driving enthusiasts and motorsport learners, supported by positive customer reviews and professional branding. Technically, the website is built on WordPress using the Avada theme and WooCommerce for e-commerce functionality. It integrates modern marketing and analytics tools such as Google Analytics, Facebook Pixel, and Trustindex for customer reviews. The site is mobile-optimized with good SEO practices but lacks some advanced accessibility features. Performance is moderate, with asynchronous loading of scripts and optimized images. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect forms. However, it lacks visible security headers and published security or incident response policies. Privacy compliance is weak due to the absence of explicit privacy and cookie policies or consent mechanisms. Business credibility is high, supported by clear service offerings, accreditation, and trust signals. Overall, the website presents a professional and trustworthy front for Silverstone Rally School but should improve privacy compliance and security transparency to enhance user trust and regulatory adherence.

65
37
100
55
58
25
2
rallymotorsportdrivingschoolrallydrivingsilverstone+3 more
WordPressWooCommercejQueryYoast SEO+6
2026-06-27T07:05:57.189Z
xcomm.co.uk favicon

X.Communications Ltd

xcomm.co.uk

62
TechnologyUnited KingdommediumMEDIUM

X.Communications Ltd (Xcomm) is a well-established UK-based provider of enterprise communication solutions, including network services, security, unified communications, and hosted telephony. The company targets a broad range of clients from small businesses to FTSE 100 companies and public sector organizations. Their market position is strengthened by partnerships with leading technology vendors such as Cisco and Cisco Meraki, and a portfolio of managed services and consultancy offerings. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress using modern plugins and libraries, delivering moderate performance and good mobile optimization. SEO practices are well implemented with proper meta tags and structured data. However, accessibility features are basic and could be improved. Security posture is solid with HTTPS enforced and no visible sensitive data exposure, but lacks some security headers and explicit incident response contacts. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. Overall, the website and domain demonstrate high legitimacy and trustworthiness, supported by consistent WHOIS data and a long domain age. The absence of blocking mechanisms or WAF challenges allows full content analysis. Strategic improvements in privacy compliance, security headers, and incident response transparency would enhance the security posture and user trust.

67
70
100
65
35
55
25
enterprisesolutionsnetworkservicessecurityservicesunifiedcommunicationshostedtelephony+4 more
WordPressPHPjQueryLayerSlider+3

Partner Domains:

linebroker.co.uk
subsidiary
2026-06-27T07:05:41.275Z
wakefieldacoustics.co.uk favicon

Wakefield Acoustics

wakefieldacoustics.co.uk

66
EnergyUnited KingdommediumMEDIUM

Wakefield Acoustics is a UK-based company specializing in industrial noise control solutions, including acoustic enclosures, containers, louvres, and consultancy services. Established in 1999, the company serves industrial clients primarily in the energy and manufacturing sectors, offering design, manufacturing, and installation services to ensure compliant and sustainable operations. The website reflects a professional and consistent brand image, with clear navigation and relevant content tailored to its target audience. Technically, the site is built on WordPress with modern optimization tools like NitroPack and uses standard web technologies such as jQuery and Font Awesome. Performance and mobile optimization are good, contributing to a positive user experience. Security posture is solid with HTTPS enforced and no visible vulnerabilities, though the absence of explicit security headers and security policies suggests room for improvement. Privacy compliance is limited due to missing privacy and cookie policies, which should be addressed to meet GDPR requirements. Overall, the domain registration data supports the legitimacy of the business, and the partnership with CECO Environmental adds trust. Strategic recommendations include enhancing privacy compliance, publishing security policies, and implementing security headers to strengthen the security posture.

52
100
70
70
17
53
80
industrialnoisecontrolacousticenclosuresnoisecontrolservicesukmanufacturing+1 more
WordPressNitroPack optimizationjQuerySlick Carousel+2

Partner Domains:

cecoenviro.com
partner
2026-06-27T07:04:58.647Z
bayford.co.uk favicon

Bayford Group

bayford.co.uk

47
EnergyUnited KingdommediumHIGH

The Bayford Group is a well-established UK-based diversified business with over 100 years of history, operating primarily in energy, property, hospitality, and investments. Their website reflects a professional and consistent brand presence, showcasing their key services and business sectors clearly. The company targets business clients and investors interested in these sectors, leveraging a diversified business model with a strong heritage in energy and expanding into green technologies and property investments. Technically, the website is built on WordPress with modern frameworks like Bootstrap and uses common plugins such as Contact Form 7 and WPBakery Page Builder. The site is mobile-optimized and includes Google Analytics and reCAPTCHA for security and analytics. However, some technical improvements could be made, such as adding security headers and cookie consent mechanisms to enhance compliance and security posture. From a security perspective, the site uses HTTPS and implements Google reCAPTCHA on its contact form, which are positive indicators. However, the absence of explicit security headers and incident response information suggests room for improvement in security maturity. No vulnerabilities or suspicious content were detected, and the domain's long history supports legitimacy. Overall, the Bayford Group website presents a credible and professional business presence with moderate technical sophistication and a good security baseline. Strategic enhancements in privacy compliance and security policies would further strengthen their digital trust and regulatory adherence.

80
57
-
70
53
17
15
energypropertyhospitalityinvestmentsbusiness+1 more
WordPress 7.0BootstrapjQueryGoogle reCAPTCHA+5

Partner Domains:

linkedin.com
partner
2026-06-27T07:04:42.714Z