Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 25 of 1064|Showing 1201-1250 of 53176
vassar.edu favicon

Vassar College

vassar.edu

69
EducationUnited StatesmediumMEDIUM

Vassar College is a well-established liberal arts college in the Northeastern United States, offering a broad range of academic programs and a vibrant campus life. The website reflects a professional and comprehensive digital presence, targeting prospective and current students, families, alumni, and employees. The institution positions itself as a top liberal arts college with a strong emphasis on academic rigor and community engagement. Technically, the website is built on Drupal 11 with modern web technologies including Google Tag Manager for analytics and Monsido for heatmaps. The site is mobile-optimized, accessible, and SEO-friendly, providing a positive user experience. The use of HTTPS and cookie consent mechanisms indicates attention to security and privacy compliance. Security posture is solid with HTTPS and no visible vulnerabilities, though the site could improve by adding explicit security headers and publishing a security policy or incident response contacts. The absence of WHOIS data is typical for .edu domains and does not detract from the legitimacy of the institution. Overall, the website demonstrates a mature digital infrastructure suitable for an educational institution. Recommendations include enhancing security headers, publishing a vulnerability disclosure policy, and providing clearer contact information for security incidents to strengthen trust and compliance further.

67
70
100
80
40
25
83
educationliberalartscollegeuniversityhighereducation+3 more
Drupal 11Google Tag ManagerMonsido heatmapsVimeo Player+1
2026-07-11T07:08:30.571Z
europlusdirect.com favicon

EPD Worldwide

europlusdirect.com

56
TechnologyUnited KingdommediumMEDIUM

EPD Worldwide is a specialized IT services company focusing on simplifying and enhancing the renewal of IT services with OEMs globally. Leveraging over 10 years of expertise, advanced technology, and data analytics, they provide multi-country and multi-OEM IT service procurement solutions. Their services aim to reduce complexity and cost while increasing renewal rates and revenue for their clients. The company operates primarily in the technology sector with a medium-sized business footprint based in the United Kingdom and is part of the Annuity Management Group. Technically, the website is built on WordPress using the Uncode theme and several plugins including GravityView and WP Rocket for performance optimization. The site employs modern web technologies such as jQuery and Google Tag Manager for analytics and marketing. Performance and mobile optimization are good, though accessibility is basic. Security is enforced via HTTPS, but lacks some advanced security headers and explicit security policies. The security posture is solid with no visible vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies and GDPR consent mechanisms. However, the absence of WHOIS registration data raises concerns about domain legitimacy and registration transparency, which impacts overall trustworthiness. Overall, EPD Worldwide presents a professional and trustworthy digital presence with strong business and technical foundations but should address domain registration transparency and enhance security headers and incident response disclosures to improve trust and compliance.

65
75
100
37
15
17
65
itservicesrenewalmanagementmulti-oemglobalitsupporttechnology+1 more
WordPressjQueryGoogle Tag ManagerWP Rocket+2
2026-07-11T07:01:12.314Z
elliottwood.co.uk favicon

Elliott Wood

elliottwood.co.uk

69
Real EstateUnited KingdommediumMEDIUM

Elliott Wood is a professional engineering consultancy based in the United Kingdom, specializing in structural engineering, sustainability, digital BIM, development infrastructure, and heritage conservation. The company positions itself as a certified B Corp committed to engineering a better society through innovative and sustainable design solutions. Their website reflects a mature digital presence with comprehensive service descriptions, multimedia content, and multiple contact channels, targeting clients and organizations in the built environment sector. Technically, the website is built on Craft CMS and employs modern web technologies including HTML5, CSS3, JavaScript, and third-party integrations such as Vimeo for video content and Swiper.js for carousels. The site is mobile-optimized, accessible, and SEO-friendly, with a cookie consent mechanism and Google Tag Manager integration for analytics and marketing. From a security perspective, the site enforces HTTPS and uses cookie consent management but lacks explicit security headers and a published security policy or incident response contacts. No vulnerabilities or exposed sensitive data were detected. The WHOIS lookup failed due to domain registration anomalies, which may be a result of querying the 'www' subdomain rather than the root domain, but the website itself appears legitimate and professionally maintained. Overall, Elliott Wood's website demonstrates strong business credibility and technical implementation with room for improvement in security transparency and WHOIS data clarity. The risk level is moderate with no critical issues detected.

70
72
65
100
60
83
17
engineeringconsultancysustainabilitybcorpstructuralengineering+2 more
HTML5CSS3JavaScriptVimeo video embeds+2
2026-07-10T07:25:50.399Z
sepha.com favicon

SEPHA

sepha.com

65
ManufacturingUnited KingdommediumMEDIUM

SEPHA Ltd is a well-established UK-based manufacturer specializing in non-destructive leak testing, blister packing, and deblistering equipment primarily for the pharmaceutical and medical device industries. With over 40 years of industry experience and a strong reputation among leading pharmaceutical manufacturers, SEPHA offers a range of products and services including quality control solutions, packaging machinery, and contract packaging services. The website reflects a mature digital presence with professional design, clear navigation, and comprehensive content tailored to its B2B audience. Technically, the site is built on WordPress with integrations of HubSpot marketing tools, Google Analytics, and other modern web technologies, ensuring good SEO and mobile optimization. Security posture is solid with HTTPS and some security headers, though improvements such as enabling DNSSEC and adding a Content-Security-Policy header are recommended. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. Overall, SEPHA demonstrates strong business credibility and digital maturity, though it could enhance transparency by publishing explicit security policies and incident response information.

57
80
100
80
15
17
83
pharmaceuticalleaktestingblisterpackingmedicaldevicepackagingqualitycontrol+2 more
WordPressYoast SEOHubSpot FormsGoogle Tag Manager+5

Partner Domains:

tasigroup.com
partner
2026-07-10T07:23:42.501Z
vanarthur.com favicon

Van Arthur Florist

vanarthur.com

61
RetailUnited KingdomsmallMEDIUM

Van Arthur Florist is a well-established local florist based in North Harrow, UK, operating since 2015. The company specializes in hand-tied floral arrangements, offering same-day delivery services across Harrow and surrounding areas. Their market position is strengthened by strong community ties, multiple certifications, and a robust online presence with extensive product offerings including wedding and funeral flowers. The business model focuses on retail sales through an e-commerce enabled website complemented by local delivery and in-store services. Technically, the website is built on ASP.NET WebForms with legacy jQuery and integrates modern marketing and analytics tools such as Google Tag Manager and Reviews.io. The site is mobile optimized and provides a good user experience with clear navigation and professional design. However, some technical debt is noted due to outdated libraries. From a security perspective, the website enforces HTTPS and uses secure forms but lacks explicit advanced security headers and public incident response policies. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with visible privacy and cookie policies and consent mechanisms. Overall, the website presents a trustworthy and professional front for the business, though the absence of WHOIS data for the domain reduces confidence in domain legitimacy. Strategic improvements in security headers and updating legacy scripts are recommended to enhance security posture and compliance.

47
75
70
100
83
17
20
floristlocalbusinessflowerdeliveryecommerceuk+2 more
jQuery 1.11.0Google Tag ManagerReviews.io widgetsStatcounter+1

Partner Domains:

master.florist
partner
britishfloristassociation.org
partner

+2 more partners

2026-07-10T07:22:59.673Z
carlainproperty.co.uk favicon

Carlain Student Houses

carlainproperty.co.uk

41
Real EstateUnited KingdomsmallHIGH

Carlain Student Houses operates as a specialist provider of student accommodation in Cheltenham, Gloucestershire, and Oxford. The company focuses on renting quality student houses located near college campuses, targeting students seeking convenient and comfortable living arrangements. Their market position is that of a niche real estate letting agency with a strong local presence and a portfolio of properties tailored to student needs. The website reflects a professional business model centered on property lettings and management services, supported by social media engagement and certifications that enhance trust. Technically, the website employs a moderately modern infrastructure including jQuery, Google Tag Manager, Google Analytics, and Google reCAPTCHA v3 for form security. The CMS appears to be CMS Made Simple, which is a common but somewhat dated platform. The site is mobile-optimized with good navigation and SEO practices, though some technical improvements could be made, such as updating libraries and adding security headers. From a security perspective, the site benefits from HTTPS and anti-bot measures on forms but lacks visible security headers and formal privacy or cookie policies, which are important for GDPR compliance. The absence of WHOIS data and domain registration details is a notable concern, potentially indicating domain registration irregularities. However, the website content and business information are consistent and professional, mitigating some trust concerns. Overall, the site presents a low to moderate risk profile with room for improvement in privacy compliance and security best practices. Strategic recommendations include implementing comprehensive privacy and cookie policies, enhancing security headers, updating technical components, and clarifying domain registration information to strengthen legitimacy and trust.

70
20
55
37
35
2
35
studentaccommodationlettingsrealestatecheltenhamgloucester+2 more
jQuery 1.12.4Google Tag ManagerGoogle Analytics (gtag.js)Google reCAPTCHA v3+1

Partner Domains:

www.clickandlet.co.uk
partner
2026-07-10T07:20:47.631Z
adaptdesign.com favicon

Adapt Design and Advertising Limited

adaptdesign.com

45
OtherJerseysmallHIGH

Adapt Design and Advertising Limited is a small creative agency based in Jersey, Channel Islands, specializing in design, advertising, brand identity, print, and website development. Established in 1997, the company serves startups, large businesses, and marketing teams with a comprehensive suite of creative services. Their market position is strengthened by a long-standing local presence and referrals extending beyond Jersey. The website reflects a professional and consistent brand image with extensive service offerings and client testimonials, indicating a trustworthy and credible business. Technically, the website employs common industry tools such as Google Analytics, Google Tag Manager, jQuery, Owl Carousel, and Revolution Slider. The site is moderately performant with good mobile optimization and basic accessibility features. SEO practices are adequately implemented with proper meta tags and structured navigation. However, no CMS or hosting provider details are evident, and some modern security best practices like security headers are missing. From a security perspective, the website uses HTTPS (implied by external scripts loaded over HTTPS), but lacks visible security headers and explicit incident response or security policy information. The absence of WHOIS data for the domain raises concerns about domain legitimacy and registration transparency, which impacts trustworthiness. Privacy and cookie policies exist but lack active consent mechanisms, indicating partial GDPR compliance. Overall, the website presents a professional and content-rich experience with moderate technical maturity and some security gaps. The missing WHOIS data and limited security policies suggest areas for improvement to enhance trust and compliance. Strategic recommendations include implementing security headers, enforcing cookie consent, clarifying domain registration details, and enhancing incident response readiness.

75
20
37
70
2
68
15
designagencyadvertisingbrandingwebdevelopmentcreativeagency+2 more
Google AnalyticsGoogle Tag ManagerjQueryOwl Carousel+2
2026-07-10T07:20:36.987Z
essex-commercial.co.uk favicon

Essex Commercial

essex-commercial.co.uk

49
TransportationUnited KingdomsmallHIGH

Essex Commercial is a UK-based small business specializing in commercial vehicle body repairs and resprays, serving clients primarily in Essex and surrounding areas. The company offers services for lorries, trucks, vans, and horse boxes, positioning itself as a local specialist with a focus on quality and customer satisfaction. The website reflects a professional and consistent brand image with clear contact details and client trust indicators such as logos from recognized brands. Technically, the website employs a modern JavaScript stack including jQuery, Modernizr, Google reCAPTCHA, and Google Tag Manager for analytics and spam protection. The site is mobile-optimized with good SEO practices but lacks visible advanced security headers and explicit cookie consent mechanisms. Performance is moderate, and accessibility is basic. From a security perspective, the site uses HTTPS and Google reCAPTCHA but does not show evidence of comprehensive security headers or incident response policies. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy. However, the website content and contact information suggest a legitimate business operation. Overall, the website scores moderately well in content quality, technical implementation, and business credibility but has room for improvement in security posture and privacy compliance. Strategic recommendations include enhancing security headers, implementing cookie consent, verifying domain registration, and publishing clear security and privacy policies.

20
60
57
85
68
30
2
commercialvehiclerepairbodyworkresprayessexvehiclerepair+1 more
jQuery 3.6.0Modernizr 3.11.2Google reCAPTCHAGoogle Tag Manager+4
2026-07-10T07:20:31.666Z
bridgegate-security.co.uk favicon

Bridgegate Security (UK) Limited

bridgegate-security.co.uk

62
HospitalityUnited KingdomlargeMEDIUM

Bridgegate Security (UK) Limited is a well-established security service provider specializing in hospitality security, door supervision, and event security across the United Kingdom. Founded in 1978, the company has grown to become one of the largest independent security contractors in the UK, serving bars, pubs, nightclubs, and venues with experienced SIA-licensed personnel. Their market position is reinforced by certifications such as the SIA Approved Contractor status and founding membership in the UK Door Security Association (UKDSA). The website reflects a professional and trustworthy business with clear service offerings and strong client testimonials. Technically, the website is built on WordPress with modern plugins including Yoast SEO and Cookie Law Info, ensuring good SEO and privacy compliance. The site is mobile-optimized, fast-loading, and accessible, with a comprehensive cookie consent mechanism that aligns with GDPR requirements. Hosting and domain registration are consistent with the business's UK location and history, registered with a reputable UK registrar. From a security perspective, the site uses HTTPS and implements cookie consent controls, but lacks explicit security headers and incident response contact details. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong with clear policies and consent mechanisms. Overall, the site demonstrates a mature security posture suitable for its business sector. The overall risk assessment is low, with recommendations to enhance security headers, publish incident response contacts, and consider a vulnerability disclosure policy to further strengthen trust and compliance.

60
62
100
85
20
2
80
securityhospitalitydoorsupervisioneventsecuritysiaapproved+2 more
WordPressYoast SEOSwiper SliderGoogle Tag Manager+1

Partner Domains:

bridgegatesecurity.live-website.com
partner
whistleblowing.paperform.co
service
2026-07-10T07:19:27.540Z
biomap.co.uk favicon

Biomap Limited

biomap.co.uk

57
HealthcareUnited KingdomsmallMEDIUM

Biomap Limited is a specialized provider of temperature monitoring and mapping services tailored for the Life Sciences industry, including pharmaceutical manufacturing, distribution, and clinical environments. Established in 2009, the company has built a strong reputation with nearly two decades of experience and a client base that includes major pharmaceutical and healthcare organizations. Their offerings encompass both services such as temperature mapping, packaging qualification, calibration, and shipping studies, as well as products like continuous monitoring systems and data loggers sourced from reputable partners. The website reflects a professional and consistent brand image, targeting B2B clients in healthcare and life sciences sectors primarily within the UK. Technically, the website is built on WordPress with modern front-end libraries and integrates Google Analytics, Google Tag Manager, and reCAPTCHA for tracking and security. The site is mobile-optimized and SEO-friendly with structured data and Open Graph metadata. However, some security best practices such as security headers and cookie consent mechanisms are missing, which could be improved to enhance compliance and security posture. Security-wise, the site uses HTTPS and employs reCAPTCHA on forms, but lacks explicit security policies and incident response information. No vulnerabilities or suspicious content were detected. The domain registration data is consistent with the business claims, showing a long-standing presence and no privacy protection, which supports legitimacy. Overall, Biomap Limited presents a credible, professional online presence with good technical implementation and business credibility. Strategic improvements in security headers, privacy compliance (cookie consent), and incident response transparency would further strengthen their security posture and regulatory compliance.

47
65
100
70
15
17
58
temperaturemappinglifesciencespharmaceuticaltemperaturemonitoringcalibration+2 more
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+4

Partner Domains:

cryopak.com
partner
labcold.com
partner

+1 more partners

2026-07-10T07:18:38.136Z
hippowaste.co.uk favicon

Waste Management Systems Ltd.

hippowaste.co.uk

67
TransportationUnited KingdommediumMEDIUM

HIPPO, operated by Waste Management Systems Ltd., is a well-established UK-based rubbish removal service provider with over 20 years of experience. The company offers a variety of waste disposal solutions including HIPPOBAG, Man and Van, Skip Hire, and trade waste services, targeting both residential and business customers across the UK. Their market position is strong, supported by certifications such as ISO14001 and ISO9001, and a high customer satisfaction rating on Trustpilot. The website reflects a professional and trustworthy brand with consistent branding and comprehensive service information. From a technical perspective, the website employs modern web technologies including jQuery, Google Tag Manager, Trustpilot widgets, and OneTrust for cookie consent management. The site is mobile-optimized with good SEO practices and moderate performance. Security posture is generally good with HTTPS enforced and cookie consent mechanisms in place, though some security headers are not explicitly detected and no public security policy or incident response contacts are found. The WHOIS data for the domain is incomplete and indicates an error related to domain naming rules, likely due to querying the 'www' subdomain instead of the root domain. Despite this, the website content and business information appear legitimate and professional. No adult or NSFW content is present, and privacy compliance is well addressed with clear policies and consent banners. Overall, HIPPO presents a credible and professional online presence with strong business credibility and good technical implementation. Security can be improved by adding explicit security headers and publishing incident response information. The WHOIS discrepancy should be clarified by querying the correct domain name.

77
65
100
75
2
73
65
rubbishremovalwastemanagementskiphirehippobagmanandvan+3 more
jQueryGoogle Tag ManagerTrustpilot WidgetOneTrust Cookie Consent+2
2026-07-10T07:18:06.232Z
T

TJ Williams Ltd

tjwilliams.co.uk

49
ManufacturingUnited KingdommediumHIGH

TJ Williams Ltd is a well-established UK-based manufacturer specializing in precision handcrafted pressure, level, and temperature instrumentation with over 150 years of industry presence. The company offers a comprehensive range of products including pressure gauges, calibration and repair services, bespoke designs, and acts as an official distributor for Kobold UK. Their market position is strong within the industrial manufacturing sector, targeting engineers and industrial clients requiring reliable instrumentation solutions. Technically, the website is built on a modern WordPress CMS with WooCommerce integration, leveraging Themify Ultra theme and jQuery libraries. The site is hosted via Cloudflare, ensuring good performance and security at the network level. Mobile optimization and SEO practices are well implemented, although accessibility features could be improved. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks several recommended security headers and a cookie consent mechanism, which impacts GDPR compliance. No explicit security policies or incident response contacts are published, indicating room for improvement in security transparency and readiness. Overall, the website is professional, trustworthy, and business-focused with a solid technical foundation. Strategic enhancements in privacy compliance and security best practices would further strengthen the company's digital maturity and customer trust.

57
20
70
65
20
17
58
pressuregaugesmanufacturingindustrialinstrumentationcalibrationrepair+2 more
WordPress 7.0WooCommerce 10.9.3jQueryThemify Ultra Theme+2

Partner Domains:

kobold.com
partner
2026-07-10T07:16:35.887Z
dalrod.co.uk favicon

DALROD

dalrod.co.uk

52
OtherUnited KingdommediumMEDIUM

DALROD UK Ltd is a professional drainage service provider offering expert 24/7 rapid response drainage solutions across the United Kingdom. Their services include drain cleaning, unblocking, repairs, CCTV surveys, liquid waste disposal, and emergency drainage services. The company positions itself as a trusted and accredited provider with over 35 years of experience, serving both residential and commercial customers nationwide. The website reflects a mature digital presence with comprehensive service descriptions, customer testimonials, and multiple industry certifications, indicating a strong market position. Technically, the website is built on WordPress using Elementor and Yoast SEO plugins, integrating modern analytics and marketing tools such as Google Analytics, Microsoft Clarity, and Trustist reviews. The site is mobile-optimized, accessible, and SEO-friendly, with a cookie consent mechanism in place to comply with privacy regulations. The technical infrastructure is solid, though some security headers could be improved to enhance security posture further. From a security perspective, the site enforces HTTPS and employs consent-based tracking, demonstrating good privacy compliance. No critical vulnerabilities or exposed sensitive data were detected. However, the WHOIS lookup for the subdomain 'www.dalrod.co.uk' failed due to a naming rules violation, likely because the query was made on the subdomain rather than the registered domain 'dalrod.co.uk'. This does not detract from the legitimacy of the business as evidenced by the website content and structured data. Overall, DALROD presents a trustworthy and professional online presence with strong business credibility and compliance. Strategic improvements in security headers and ongoing monitoring of third-party scripts are recommended to maintain and enhance security posture.

40
57
65
75
80
15
2
drainagedrainrepairdrainunblockingcctvdrainsurveysemergencyservices+3 more
WordPressElementorYoast SEOGoogle Tag Manager+3
2026-07-10T07:16:30.535Z
walsingham.com favicon

Walsingham Support

walsingham.com

57
Non-profitUnited KingdommediumMEDIUM

Walsingham Support is a well-established UK-based charity providing personalized support services for individuals with learning disabilities, autism, brain injuries, and complex needs. With over 40 years of experience, the organization offers bespoke support solutions ranging from a few hours weekly to full 24/7 care. The website reflects a professional and consistent brand image, targeting individuals and families seeking specialized disability support. The charity emphasizes its commitment to quality of life and happiness for its clients. Technically, the website employs a modern technology stack including jQuery, Google Tag Manager, and a proprietary CMS (Grandad Digital). It is mobile-optimized, accessible, and includes cookie consent mechanisms aligned with GDPR requirements. Analytics tools such as Google Analytics and Hotjar are used with user consent. However, some security best practices such as explicit security headers and published security policies are missing. From a security perspective, the site uses HTTPS and manages cookie consent effectively, but lacks visible security policies and incident response contacts. The WHOIS data is unavailable, which raises concerns about domain registration legitimacy and consistency with the claimed 40-year history. No critical vulnerabilities or unsafe content were detected. Overall, the website is professional and trustworthy in content and design but would benefit from improved transparency in domain registration and enhanced security documentation to strengthen trust and compliance.

70
75
100
37
15
83
2
charitydisabilitysupportnon-profitlearningdisabilitiesautism+3 more
jQueryjQuery UIGoogle Tag ManagerGoogle Analytics+2
2026-07-10T07:13:33.156Z
B

Blackstone Mortgage Trust

blackstonemortgagetrust.com

71
Real EstateUnited StateslargeMEDIUM

Blackstone Mortgage Trust (BXMT) is a publicly traded commercial mortgage REIT specializing in real estate credit investments across North America, Europe, and Australia. Managed by Blackstone Inc., the largest owner of commercial real estate globally, BXMT leverages significant data, resources, and a global platform to underwrite complex transactions and partner with leading sponsors. The website presents comprehensive investor information, financial disclosures, and market positioning that reflect a mature and professional business entity. Technically, the website is built on WordPress with modern SEO and accessibility practices, integrating advanced analytics and monitoring tools such as New Relic and Google Tag Manager. The site is well-optimized for performance and mobile responsiveness, with a clear navigation structure and consistent branding. From a security perspective, the site enforces HTTPS and employs cookie consent mechanisms compliant with GDPR. While explicit security policies and incident response contacts are not published, the use of monitoring tools and privacy policies indicates a reasonable security posture. The absence of WHOIS registration data is a concern but is mitigated by the strong brand presence and external references to Blackstone domains. Overall, the website demonstrates a high level of professionalism, trustworthiness, and compliance suitable for its investor audience. Strategic recommendations include publishing explicit security policies, incident response contacts, and improving WHOIS transparency to enhance trust further.

70
32
85
100
80
17
100
realestatereitfinanceinvestorrelationsmortgagetrust+1 more
WordPressYoast SEOBrightcove video playerNew Relic monitoring+2

Partner Domains:

www.blackstone.com
parent
ir.blackstonemortgagetrust.com
subsidiary
2026-07-10T07:13:22.515Z
naiop.org favicon

Commercial Real Estate Development Association

naiop.org

62
Real EstateUnited StateslargeMEDIUM

The Commercial Real Estate Development Association (CREDA) is a leading professional organization dedicated to advancing commercial real estate development across North America. The association provides a comprehensive suite of services including industry education, advocacy on legislative priorities, research publications, and networking opportunities through events and chapters. CREDA targets commercial real estate professionals such as developers, owners, investors, and industry stakeholders, positioning itself as a key resource and thought leader in the sector. Technically, the CREDA website is built on the EPiServer CMS platform and leverages modern web technologies including jQuery, Google Analytics, Microsoft Application Insights, and various UI libraries for a responsive and user-friendly experience. The site demonstrates good mobile optimization and SEO practices, although some accessibility features could be enhanced. Performance is moderate with room for optimization. From a security perspective, the website enforces HTTPS and employs CAPTCHA on forms to mitigate abuse. However, no explicit security headers were detected in the provided data, and there is no visible incident response or vulnerability disclosure information. Privacy compliance is well addressed with a comprehensive privacy policy, cookie consent mechanisms, and GDPR considerations. The WHOIS data is unavailable or privacy-protected, which is common for organizations of this nature. Overall, CREDA presents a professional, trustworthy, and content-rich online presence with a solid technical foundation. Strategic improvements in security headers, incident response transparency, and accessibility would further strengthen its security posture and user trust.

27
100
78
75
30
17
85
commercialrealestatedevelopmentassociationeducationadvocacy+2 more
EPiServer CMSjQueryGoogle AnalyticsMicrosoft Application Insights+4
2026-07-10T07:12:39.921Z
shelbyenergy.com favicon

Shelby Energy Cooperative

shelbyenergy.com

66
EnergyUnited StatesmediumMEDIUM

Shelby Energy Cooperative is a regional electric utility cooperative serving Shelbyville, Kentucky, and surrounding areas. The organization focuses on providing safe, reliable, and cost-effective energy solutions to its members, including residential and business customers. Key services include energy provision, account management via SmartHub, energy audits, renewable energy programs, and electric vehicle resources. The cooperative positions itself as a trusted community energy provider with a strong local presence and customer service focus. Technically, the website is built on the Drupal CMS platform, utilizing modern web technologies such as FontAwesome, Google Tag Manager, and GTranslate for multilingual support. The site demonstrates good mobile optimization, accessibility features, and SEO practices, although performance is moderate. The infrastructure appears stable and professionally maintained. From a security perspective, the website enforces HTTPS and avoids exposing sensitive data. However, it lacks several security headers and does not provide explicit security policies or incident response information. Privacy compliance is basic, with a privacy policy present but no cookie consent mechanism detected. The absence of WHOIS data reduces domain trustworthiness, though the website content and external partnerships suggest legitimacy. Overall, Shelby Energy Cooperative's digital presence is professional and functional, supporting its business objectives effectively. Strategic improvements in security headers, privacy compliance, and domain registration transparency would enhance trust and security posture.

80
62
100
70
85
53
2
energycooperativeutilityrenewableenergyelectricvehicles+1 more
Drupal CMSFontAwesomeGoogle Tag ManagerGoogle Analytics+3

Partner Domains:

shelbyenergy.smarthub.coop
partner
coopwebbuilder3.com
partner
2026-07-10T07:12:34.641Z
foulston.com favicon

Foulston Siefkin LLP

foulston.com

76
OtherUnited StateslargeLOW

Foulston Siefkin LLP is the largest Kansas-based law firm, providing a broad range of legal services including corporate and business law, healthcare law, litigation, and employment law. The firm targets businesses and individuals seeking professional legal counsel, positioning itself as a leading regional legal service provider with a strong market presence in Kansas and surrounding areas. Their website reflects a professional and comprehensive approach, featuring detailed practice areas, attorney search capabilities, and client testimonials, supporting their market leadership claims. Technically, the website employs modern web technologies such as jQuery, Bootstrap, Owl Carousel, and integrates Google Tag Manager and CookieYes for analytics and privacy compliance. The site is mobile-optimized, accessible, and SEO-friendly, with structured data enhancing search engine understanding. Performance is moderate, with room for optimization. From a security perspective, the site uses HTTPS and cookie consent mechanisms effectively, but lacks visible security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were detected in the provided content. The absence of WHOIS data is a notable anomaly that warrants further investigation to confirm domain registration legitimacy. Overall, the website presents a low-risk profile with strong business credibility and privacy compliance, though improvements in security policy transparency and domain registration verification are recommended to enhance trust and security posture.

47
80
80
100
47
83
90
lawfirmlegalservicescorporatelawhealthcarelawlitigation+3 more
jQueryBootstrap 4.3.1Owl CarouselCookieYes Consent Management+1
2026-07-10T07:12:29.296Z
dol.gov favicon

U.S. Department of Labor

dol.gov

67
GovernmentUnited StatesenterpriseMEDIUM

The U.S. Department of Labor (DOL) is a federal government agency dedicated to promoting the welfare of job seekers, wage earners, and retirees in the United States. The website serves as a comprehensive portal for labor laws, workplace safety, unemployment insurance, apprenticeship programs, and disaster recovery assistance. It targets American workers, employers, and government entities, providing authoritative resources and regulatory information. The DOL maintains a strong market position as a key government institution with enterprise-level scale and reach. Technically, the website is built on Drupal 10 CMS, leveraging modern web technologies including Google Analytics, Google Tag Manager, and various accessibility and performance tools. The site demonstrates good mobile optimization, accessibility, and SEO practices, with asynchronous loading of analytics scripts to enhance performance. The design is professional, consistent, and user-friendly, reflecting the agency's authoritative brand. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and a public vulnerability disclosure policy. Privacy compliance is strong with a comprehensive privacy policy and GDPR considerations, though a cookie consent mechanism is not evident. The WHOIS data is privacy protected or unavailable, typical for .gov domains, but the domain legitimacy is high given the official .gov TLD and consistent branding. Overall, the DOL website is a secure, credible, and well-maintained government resource. Strategic recommendations include enhancing security headers, publishing vulnerability disclosure information, implementing cookie consent, and providing incident response contacts to further strengthen trust and compliance.

85
80
100
67
30
58
25
governmentlaboremploymentworkplacesafetyunemployment+2 more
Drupal 10Google AnalyticsGoogle Tag ManagerFontAwesome+3
2026-07-10T07:12:23.950Z
silvershieldwindscreens.co.uk favicon

Silver Shield Windscreens

silvershieldwindscreens.co.uk

50
TransportationUnited KingdomsmallMEDIUM

Silver Shield Windscreens is a UK-based company specializing in automotive glass repair and replacement services, including windscreen repairs, replacements, fleet services, specialist glazing, and ADAS recalibration. The company targets fleet owners, business owners, and private vehicle owners across England and Wales, emphasizing quality service at competitive prices with trained technicians and insurance claim support. The website presents a professional image with clear contact details and service descriptions. Technically, the website employs legacy technologies such as jQuery 1.8.3 and Modernizr 2.6.2, alongside Google Analytics and Tag Manager for tracking. The site is mobile-optimized with a cookie consent mechanism, but lacks visible modern security headers and uses an outdated JavaScript library, which may pose security risks. Performance is moderate, and SEO practices are adequately implemented. From a security perspective, the site uses HTTPS (assumed from external scripts loaded via HTTPS), but no explicit security headers were detected in the provided data. The cookie consent banner and privacy policies indicate GDPR compliance efforts, though no incident response or vulnerability disclosure information is present. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy, though the website content is consistent with a legitimate business. Overall, the website is functional and professional but would benefit from technical and security improvements, including updating libraries, implementing security headers, and clarifying domain registration status to enhance trust and compliance.

47
60
85
20
15
95
2
windscreenrepairwindscreenreplacementfleetservicesadasrecalibrationspecialistglazing+3 more
jQuery 1.8.3Google AnalyticsGoogle Tag ManagerModernizr 2.6.2+1
2026-07-10T07:09:34.977Z
geobear.co.uk favicon

Geobear UK

geobear.co.uk

66
Real EstateUnited KingdommediumMEDIUM

Geobear UK is a specialized ground engineering company focused on providing fast, non-disruptive solutions for residential and commercial foundation problems caused by subsidence. The company positions itself as a niche expert in subsidence repair across the UK, targeting homeowners and commercial property owners. Their key services include subsidence repair, residential foundation stabilization, and infrastructure ground engineering. The website reflects a professional and consistent brand image with clear navigation and contact options, supporting their market position. Technically, the website is built on the HubSpot CMS platform, utilizing modern technologies such as Bootstrap for responsive design, Google Tag Manager for analytics management, and Cookiebot for privacy compliance. The site is mobile-optimized and demonstrates good SEO and accessibility practices. Hosting appears to be supported by Cloudflare, enhancing performance and security. From a security perspective, the website enforces HTTPS and employs cookie consent mechanisms that comply with GDPR. Security headers are partially detected or implied, and no critical vulnerabilities or exposed sensitive data were found in the content. The WHOIS data is privacy-protected, which is common for businesses of this type, and does not raise immediate trust concerns given the professional website presence. Overall, the website presents a low-risk profile with strong business credibility and good privacy compliance. Strategic recommendations include enhancing explicit security headers, continuous monitoring of third-party scripts, and ensuring robust form security to maintain and improve the security posture.

75
100
49
70
95
2
50
subsidencefoundationrepairgroundengineeringukconstruction+4 more
HubSpot CMSGoogle Tag ManagerCookiebotBootstrap+2

Partner Domains:

villaagare.geobear.com
subsidiary
underpinning.geobear.com
subsidiary

+3 more partners

2026-07-10T07:08:52.027Z
satbill.co.uk favicon

Symbiosys Business Solutions Ltd

satbill.co.uk

66
TelecommunicationsUnited KingdommediumMEDIUM

Symbiosys Business Solutions Ltd operates the SATbill platform, a specialized satellite airtime billing solution designed for satellite service providers and operators worldwide. The company offers a comprehensive software product that supports billing for multiple providers, call types, and value-added services, with strong customization and integration capabilities. Their market position is supported by a global client base, multi-entity billing features, and significant invoicing volume, positioning them as a key player in the satellite telecommunications billing niche. Technically, the website is built on the HubSpot CMS platform, leveraging modern web technologies including Google Fonts, jQuery, and various analytics and marketing tools such as Google Analytics, Hotjar, and LinkedIn Insight. The site is well-optimized for mobile and accessibility, with good SEO practices and a professional design that enhances user experience. From a security perspective, the site enforces HTTPS, uses reCAPTCHA on forms, and benefits from HubSpot's security headers and infrastructure. However, the absence of explicit security policy pages and vulnerability disclosure mechanisms suggests room for improvement in transparency and incident response readiness. The WHOIS data is missing or indicates the domain may not be registered, which raises concerns about domain legitimacy despite the professional website content. Overall, the website presents a trustworthy and professional front for a specialized business solution, but the lack of WHOIS registration data and explicit security policies slightly reduce the overall trust score. Strategic recommendations include establishing clear security and incident response documentation, verifying domain registration, and enhancing transparency to strengthen stakeholder confidence.

44
70
60
100
75
17
83
satellitebillingtelecommunicationssoftwaresatcom+2 more
HubSpot CMSGoogle FontsjQuerySlick Carousel+7
2026-07-10T07:07:26.842Z