Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 25 of 251|Showing 1201-1250 of 12548
myclickfunnels.com favicon

ClickFunnels

myclickfunnels.com

63
TechnologyN/alargeMEDIUM

ClickFunnels is a technology company specializing in providing a SaaS platform for building sales funnels and marketing automation. The website analyzed is a login page for the accounts subdomain, indicating a user authentication portal for their services. The company targets entrepreneurs, marketers, and small to medium businesses aiming to grow their sales through optimized funnels. The platform is positioned as a leading provider in the sales funnel software market, offering tools for lead generation and conversion optimization. Technically, the site uses modern web technologies including Ruby on Rails backend indicators, Turbo (Hotwire) framework, and a variety of marketing and analytics tools such as Microsoft Clarity, Facebook Pixel, Google Tag Manager, and Appcues. The site is served over HTTPS with CSRF protection tokens, indicating basic security hygiene. However, the page lacks explicit security headers and comprehensive privacy or cookie policies, which are important for compliance and user trust. From a security perspective, the site shows good SSL configuration and secure form handling but could improve by implementing additional security headers and providing clear privacy and security policies. No vulnerabilities or exposed sensitive data were detected in the provided content. The absence of WHOIS data for the subdomain is typical and does not indicate risk. Overall, the domain and subdomain appear legitimate and consistent with the brand. The overall risk assessment is moderate due to the lack of explicit privacy and cookie policies and limited contact information on the login page. Strategic recommendations include enhancing security headers, publishing comprehensive privacy and cookie policies with consent mechanisms, and providing clear contact channels for security incidents to improve compliance and user trust.

70
35
22
72
57
85
100
clickfunnelsfunnelmarketingsalessaas+1 more
FontAwesome Pro 6.7.2Google Tag ManagerMicrosoft ClarityFacebook Pixel+2
2025-10-30T12:02:38.513Z
worksafesask.ca favicon

WorkSafe Saskatchewan

worksafesask.ca

47
GovernmentCanadamediumHIGH

WorkSafe Saskatchewan is a government agency dedicated to promoting workplace health and safety within the province of Saskatchewan, Canada. The organization provides regulatory oversight, educational resources, and support services to employers and workers to foster safe working environments. The website serves as a comprehensive portal for information, incident reporting, and access to safety programs, positioning WorkSafe Saskatchewan as the authoritative body in its sector. Technically, the website is built on WordPress using the Avada theme and incorporates modern web technologies including jQuery, Google Analytics, Facebook Pixel, and LinkedIn Insight Tag for analytics and marketing. The site demonstrates good mobile optimization and accessibility features, though there is room for improvement in accessibility compliance. Performance is moderate, with a well-structured layout and clear navigation enhancing user experience. From a security perspective, the site enforces HTTPS, employs multiple security headers, and avoids exposing sensitive data. However, it lacks a publicly available security policy and vulnerability disclosure mechanism, which are recommended for transparency and incident management. Privacy compliance is strong, with clear privacy and cookie policies and consent mechanisms in place, reflecting adherence to GDPR principles. Overall, the website is professional, trustworthy, and well-maintained, serving its government mandate effectively. The absence of WHOIS data is noted but likely due to registry policies rather than malicious intent. Strategic recommendations include publishing a formal security policy, implementing a vulnerability disclosure program, and enhancing accessibility to further strengthen the site's security posture and user inclusivity.

15
68
17
40
62
70
20
workplacesafetygovernmentsaskatchewanhealthandsafetyregulatory+1 more
WordPressjQueryGoogle AnalyticsFacebook Pixel+5

Partner Domains:

ccohs.ca
partner
2025-10-30T12:01:17.621Z
finansforbundet.no favicon

Finansforbundet

finansforbundet.no

10
FinanceNorwaylargeCRITICAL

Finansforbundet is Norway's largest trade union in the finance sector, representing approximately 36,000 members. The organization focuses on improving salary conditions, competence development, and creating attractive workplaces for finance employees. Their website reflects a professional and well-established entity with a clear market position as a leading finance sector union in Norway. The site offers legal assistance and exclusive member benefits, targeting finance sector employees primarily in Norway. Technically, the website is built on WordPress with modern plugins and tracking tools such as Google Tag Manager, Facebook Pixel, and Adform. It employs Cloudinary for optimized image delivery and demonstrates good SEO practices with structured data and meta tags. The site is mobile-optimized and performs moderately well, though some improvements in security headers and privacy compliance could be made. From a security perspective, the site uses HTTPS and does not expose sensitive data. However, explicit security headers are not clearly detected, and no visible privacy or cookie policy is present in the analyzed content. The WHOIS data is privacy-protected under Norid, which is typical for Norwegian domains, and the domain appears legitimate and consistent with the organization's identity. Overall, the website presents a strong business credibility and technical foundation but would benefit from enhanced privacy compliance and security best practices to further strengthen trust and regulatory adherence.

-
-
-
-
-
-
-
financetradeunionnorwaylegalassistancememberbenefits+1 more
WordPress 6.6.2Yoast SEO PremiumGoogle Tag ManagerGoogle Analytics+7
2025-10-30T11:40:36.649Z
styrke.no favicon

Styrke

styrke.no

9
EnergyNorwaylargeCRITICAL

Forbundet Styrke is a large Norwegian union representing members primarily in the energy sector, including oil, gas, land industry, management, and technology. It is positioned as the fourth largest union within the Norwegian Confederation of Trade Unions (LO). The website serves as an informational and membership portal, targeting professionals and workers in these sectors. The business model revolves around union membership and representation services. Technically, the website is built on WordPress with modern SEO and consent management tools such as Yoast SEO and Cookiebot, indicating a mature digital infrastructure. The site employs multiple third-party tracking and advertising technologies, including Google Analytics, Facebook Pixel, LinkedIn Insight, and Adform, reflecting an extensive marketing and analytics setup. Security posture is generally strong with HTTPS enforced and cookie consent mechanisms in place; however, explicit security policies and incident response contacts are absent. WHOIS data shows inconsistencies, particularly a domain creation date in the future, which lowers trustworthiness but does not negate the legitimacy suggested by the website content and social media presence. Overall, the site is professional, well-structured, and compliant with cookie consent regulations but would benefit from clearer privacy policies and contact information to enhance trust and compliance.

-
-
-
-
-
-
-
unionenergyoilgastechnology+4 more
WordPress 6.6.2Yoast SEO PremiumGoogle Tag ManagerCookiebot CMP+5
2025-10-30T11:40:01.309Z
foam-expo.eu favicon

Informa Markets

foam-expo.eu

60
ManufacturingGermanylargeMEDIUM

Foam Expo Europe is a leading B2B trade exhibition and conference focused on the foam industry, organized by Informa Markets. The event is positioned as Europe's largest free trade fair for technical foam products and manufacturing, attracting over 200 exhibitors and industry professionals. It offers a comprehensive platform for networking, showcasing innovations, and knowledge sharing across multiple sectors including automotive, packaging, construction, and aerospace. The website is professionally designed with rich content, clear navigation, and strong branding consistency, reflecting a mature digital presence. Technically, the website employs modern frameworks such as Bootstrap 5 and jQuery, integrates multiple marketing and analytics tools including Google Tag Manager, Facebook Pixel, and Dotdigital, and implements GDPR-compliant consent management via Transcend. The site is mobile optimized and performs moderately well, with good SEO and accessibility basics. However, some security best practices like HTTP security headers and explicit incident response contacts are not evident. From a security perspective, the site uses HTTPS and secure external scripts, with no visible vulnerabilities or exposed sensitive data. The absence of WHOIS data for the domain is a notable anomaly but is mitigated by the professional nature of the site and its association with a reputable parent company. Privacy policies and terms of service are clearly linked and comprehensive, supporting compliance with GDPR. Overall, the website presents a low-risk profile with strong business credibility and digital maturity. Strategic improvements in security headers, incident response transparency, and WHOIS data availability would further enhance trust and compliance.

20
70
17
70
47
75
100
b2btradeshowfoamindustryconferenceexhibition+3 more
Bootstrap 5jQuery 3.6.0AOS (Animate On Scroll)Google Tag Manager+5

Partner Domains:

abeteefoameurope25.mapyourshow.com
partner
www.adhesivesandbondingexpo-europe.com
partner

+3 more partners

2025-10-30T11:23:27.986Z
submittable.com favicon

Submittable

submittable.com

72
TechnologyUnited StateslargeMEDIUM

Submittable is a well-established technology company specializing in SaaS solutions for grant management and corporate social responsibility (CSR) programs. Their platform serves a broad audience including foundations, governments, corporations, nonprofits, and universities. The company positions itself as a leader in providing software that streamlines grant and CSR processes, emphasizing ease of use and compliance. The website reflects a mature digital presence with strong branding, comprehensive content, and clear calls to action for demos and sales engagement. Technically, the website is built using modern frameworks such as React and Gatsby, integrated with HubSpot for marketing and analytics. The site demonstrates good performance, mobile optimization, and SEO practices. Multiple third-party analytics and marketing tools are employed, including Google Tag Manager, Facebook Pixel, and LinkedIn Insight Tag, indicating a sophisticated approach to user engagement and data collection. From a security perspective, the site enforces HTTPS and implements key security headers, contributing to a strong security posture. However, there is no publicly visible dedicated security policy or incident response contact, which could be improved to enhance transparency and trust. The absence of WHOIS data suggests domain privacy protection, which is common for businesses but should be monitored for legitimacy. Overall, Submittable presents a professional and trustworthy online presence with a strong focus on business functionality and user experience. Strategic recommendations include publishing detailed security and incident response policies and enhancing transparency around vulnerability disclosures.

65
80
17
95
52
85
100
grantmanagementcsrsoftwareemployeegivingemployeevolunteeringcommunityinvestment+4 more
ReactGatsbyHubSpotGoogle Tag Manager+4

Partner Domains:

www.wehero.co
partner
www.wizehive.com
partner

+1 more partners

2025-10-30T11:21:12.202Z
jbl.com.au favicon

JBL Australia

jbl.com.au

64
RetailAustralialargeMEDIUM

JBL Australia operates as the official distributor and retailer of JBL audio products within Australia, offering a broad range of speakers, headphones, and sound systems for consumer and professional markets. The website reflects a mature e-commerce platform with strong branding, comprehensive product offerings, and customer support services including warranty registration and product expertise. The company is positioned as a key player in the Australian audio retail sector, leveraging its affiliation with Harman International for product authenticity and support. Technically, the website is built on Salesforce Commerce Cloud (Demandware), utilizing modern JavaScript libraries such as jQuery, Modernizr, and analytics tools including Google Tag Manager, Facebook Pixel, and Hotjar. The site demonstrates good mobile optimization, SEO practices, and accessibility basics, though there is room for improvement in accessibility features. Performance is moderate, with asynchronous loading of scripts and lazy loading of images. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes standard security headers. Cookie consent mechanisms are implemented, supporting GDPR compliance. However, explicit security policies, incident response contacts, and vulnerability disclosure mechanisms are absent, representing areas for enhancement. No vulnerabilities or suspicious domains were detected, and the WHOIS data, while limited due to privacy, aligns with a legitimate commercial entity. Overall, JBL Australia's website presents a professional, trustworthy, and user-friendly platform with solid technical and security foundations. Strategic improvements in transparency around security policies and enhanced accessibility could further strengthen its posture.

70
68
2
50
67
70
100
audioelectronicsretaile-commerceconsumerelectronics+3 more
jQueryModernizrUnderscore.jsLazySizes+4

Partner Domains:

jblpro.com
partner
support.jbl.com
service

+1 more partners

2025-10-30T11:15:44.042Z
adhesivesandbondingexpo-europe.com favicon

Informa Markets

adhesivesandbondingexpo-europe.com

59
ManufacturingGermanylargeMEDIUM

Adhesives & Bonding Expo Europe is a major trade event organized by Informa Markets, focusing on industrial bonding solutions and services. The event is positioned as Europe's largest showcase in this sector, attracting over 200 exhibitors and 70 speakers, and is co-located with other significant expos such as Foam Expo Europe and Thermal Management Expo Europe. The website provides comprehensive information about the event, including schedules, exhibitor lists, conference agendas, and registration options, targeting industry professionals and decision-makers in manufacturing and adhesives sectors. Technically, the website employs modern web technologies including Bootstrap 5, jQuery, AOS for animations, and integrates multiple analytics and marketing tools such as Google Tag Manager, Facebook Pixel, and Optimonk. It is mobile-optimized with good SEO practices and accessibility features. The site uses HTTPS and a consent management platform (Transcend) to comply with privacy regulations. From a security perspective, the site demonstrates good practices with HTTPS enforcement and consent management but lacks explicit security headers like Content-Security-Policy and X-Frame-Options. No vulnerabilities or exposed sensitive data were detected. The WHOIS data for the domain is missing, which raises some concerns about domain registration legitimacy, although the professional content and association with Informa Markets mitigate this risk. Overall, the website is professional, trustworthy, and well-maintained, serving as a reliable platform for event information and registration. Strategic recommendations include enhancing security headers, activating CAPTCHA on forms, and monitoring domain registration status to ensure ongoing legitimacy.

15
70
17
70
47
75
100
tradeshowadhesivesbondingexpomanufacturing+4 more
jQuery 3.6.0Bootstrap 5.0.0-beta2AOS (Animate On Scroll) 2.3.1Google Tag Manager+5

Partner Domains:

foam-expo.eu
partner
thermalmanagementexpo-europe.com
partner

+3 more partners

2025-10-30T10:17:17.401Z
cosori.hu favicon

COSORI MAGYARORSZÁG

cosori.hu

59
RetailHungarysmallMEDIUM

COSORI MAGYARORSZÁG operates a professional Hungarian e-commerce website specializing in the retail of Cosori brand kitchen appliances, primarily air fryers and multifunctional cooking pots. The site targets Hungarian consumers seeking healthy and efficient cooking solutions, offering a range of products, accessories, recipes, and customer support. The business is relatively young, founded around 2021, and positions itself as an official distributor with strong trust signals such as awards and customer testimonials. Technically, the website leverages a modern e-commerce platform (ShopRenter) with a robust tech stack including jQuery, Bootstrap, and multiple marketing and analytics integrations such as Google Tag Manager, Facebook Pixel, TikTok Pixel, and Klaviyo. The site is mobile-optimized with good SEO practices and moderate performance. From a security perspective, the site enforces HTTPS and uses cookie consent mechanisms, but lacks explicit security policy pages and some recommended HTTP security headers. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with clear policies and consent banners. Overall, the website presents a low-risk profile with strong business credibility and good technical implementation. Strategic improvements could focus on enhancing security headers and publishing dedicated security and incident response information.

80
90
10
100
17
20
72
e-commercekitchenappliancesairfryerretailhungary+1 more
jQuerySlick CarouselGoogle Tag ManagerFacebook Pixel+7

Partner Domains:

www.cib.hu
partner
2025-10-30T07:37:12.858Z
nscc.ca favicon

Nova Scotia Community College

nscc.ca

69
EducationCanadalargeMEDIUM

Nova Scotia Community College (NSCC) is a prominent public educational institution in Canada offering over 140 programs across 14 campuses in Nova Scotia. The website clearly targets prospective and current students, employers, and industry partners, providing comprehensive information on programs, admissions, student supports, and campus experiences. The institution positions itself as a leading community college with a strong emphasis on inclusive, flexible, and industry-driven education. Technically, the website employs a modern technology stack including jQuery, FontAwesome, Google reCAPTCHA, and various analytics and tracking tools such as Google Tag Manager, Facebook Pixel, CrazyEgg, and Monsido for accessibility and heatmaps. The site is mobile-optimized, accessible, and SEO-friendly with clear navigation and professional design. Security posture is strong with HTTPS enforced and bot protection via reCAPTCHA, though some security headers are missing and no incident response or vulnerability disclosure information is published. Privacy compliance is good with a comprehensive privacy policy, but lacks explicit cookie consent mechanisms. Overall, the domain WHOIS data is unavailable, likely due to privacy protection, but the website content and external references strongly support legitimacy. Strategic recommendations include enhancing security headers, adding cookie consent, publishing incident response and vulnerability disclosure policies, and auditing third-party scripts regularly.

72
70
100
85
75
53
17
educationcommunitycollegenovascotiaprogramscourses+3 more
jQuery 3.7.1FontAwesome Pro 6.4.0Google reCAPTCHA v3Google Custom Search Engine+8

Partner Domains:

support.nscc.ca
service
servicedesk.nscc.ca
service

+3 more partners

2025-10-30T07:36:37.775Z
hornmedia.no favicon

Horn Media

hornmedia.no

71
MediaNorwaysmallMEDIUM

Horn Media is a Norwegian digital marketing agency specializing in serving small and medium-sized businesses (SMBs) with tailored marketing strategies including SEO, Google Ads, web design, and social media marketing. Positioned as a leading agency in Oslo, Horn Media boasts over 700 satisfied customers and a high customer rating of 4.9 out of 5. Their business model focuses on delivering comprehensive marketing plans rather than isolated services, aiming to increase client profitability through smarter investments and customer development. Technically, the website is built on the Webflow platform and integrates modern marketing and analytics technologies such as Google Tag Manager, Microsoft Clarity, Facebook Pixel, LinkedIn Insight Tag, and Cookiebot for GDPR-compliant cookie management. The site is well-optimized for performance, mobile responsiveness, and SEO, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS and employs a robust cookie consent mechanism with granular user controls. While explicit security headers are not fully confirmed, the overall posture is strong with no visible vulnerabilities or exposed sensitive data. The lack of public WHOIS data suggests privacy protection for the domain registration, which is common and justified for this business type. Overall, Horn Media presents a professional, trustworthy, and compliant digital presence with strong business credibility and technical maturity. The main risk lies in the absence of publicly available WHOIS data, but this is mitigated by the transparency and quality of the website content and services offered.

60
83
17
70
72
80
100
digitalmarketingseogoogleadssmbnorway+3 more
Google Tag ManagerCookiebotMicrosoft ClarityLinkedIn Insight Tag+4
2025-10-30T07:34:57.475Z
kargo.com favicon

Kargo HQ

kargo.com

10
TechnologyUnited StatesmediumCRITICAL

Kargo is an advertising technology company specializing in breakthrough ad solutions across mobile, connected TV (CTV), social media, and e-commerce platforms. Positioned as a major supply-side platform (SSP), Kargo emphasizes premium inventory quality, brand safety, and innovative targeting powered by AI. Their business model focuses on delivering high-impact advertising campaigns for leading brands, leveraging contextual and cohort intelligence to maximize campaign effectiveness. The company maintains a professional online presence with a well-structured website hosted on Squarespace, integrating modern marketing and analytics tools such as Google Analytics, Facebook Pixel, and HubSpot. Technically, the website is built on a modern CMS platform with good mobile optimization, SEO practices, and performance. The presence of a detailed cookie consent mechanism indicates attention to privacy compliance, although explicit privacy policy and terms of service pages are not found, which is a gap in compliance. Security posture is strong with HTTPS and HSTS enabled, but lacks explicit security policy or incident response information. The WHOIS data is notably missing or unavailable, which raises some concerns about domain registration transparency. However, the website content and business information appear legitimate and professional. Overall, the site scores well on content quality, technical implementation, and business credibility, with room for improvement in privacy compliance and WHOIS transparency.

-
-
-
-
-
-
-
advertisingtechnologymediamarketingssp+3 more
Squarespace CMSGoogle Tag ManagerGoogle AnalyticsFacebook Pixel+2
2025-10-30T07:33:08.216Z
fireballsportfederation.com favicon

International FXC Organization Inc.

fireballsportfederation.com

61
OtherUnited StatessmallMEDIUM

The International FXC Organization Inc. operates the website www.fireballsportfederation.com, promoting the Fireball Extreme Challenge™ (FXC), a mandatory coed, inclusive team ball sport designed for all genders, ages, and skill levels. The organization positions itself as an emerging global sport federation aiming to redefine athletic competition with a fast-paced cardio ball sport. The website is professionally designed using the Wix platform, featuring structured data with company contact information and a clear business description targeting sports enthusiasts worldwide. Technically, the site leverages Wix's Thunderbolt framework and includes Facebook Pixel for marketing and analytics. The site is hosted on Wix infrastructure with HTTPS enabled, ensuring secure communication. However, the site lacks visible privacy and cookie policies, security headers, and incident response contacts, indicating gaps in compliance and security best practices. The absence of WHOIS registration data for the domain raises concerns about domain legitimacy and trustworthiness. From a security perspective, the site benefits from HTTPS but lacks additional security headers and formal privacy compliance mechanisms. No vulnerabilities or exposed sensitive data were detected in the provided content. The site does not appear to be blocked by any WAF or security challenge, allowing full content access. Overall, the site demonstrates moderate security posture but requires improvements in privacy compliance and domain registration transparency. The overall risk assessment suggests moderate trustworthiness with recommendations to enhance security headers, implement comprehensive privacy and cookie policies, clarify domain registration status, and provide incident response contacts to improve user trust and regulatory compliance.

35
50
17
70
72
75
100
sportsteamsportinclusivecoedfireball+2 more
Wix.com Website BuilderJavaScriptFacebook Pixel
2025-10-30T07:17:13.770Z
integralyogaindia.org favicon

IYI India

integralyogaindia.org

52
OtherIndiamediumMEDIUM

Integral Yoga Institute (IYI India) is a well-established yoga education center based in Coimbatore, India, offering a comprehensive range of yoga programs including teacher training, yoga for special children, prenatal/postnatal yoga, and corporate wellness. The institute emphasizes holistic well-being, mindfulness, and empowerment, serving a broad audience from beginners to advanced practitioners and special needs children. With over 43 years of experience and a large student base, it holds a strong market position in the yoga education sector. Technically, the website is built on WordPress using modern plugins and frameworks such as Gravity Forms, Bootstrap, and Swiper.js. It employs Google Tag Manager and Facebook Pixel for marketing and tracking, though Google Analytics is installed but not configured. The site is mobile-optimized, accessible, and SEO-friendly with structured data implemented. From a security perspective, the site uses HTTPS and Google reCAPTCHA on forms, but lacks important security headers and publicly available privacy or cookie policies, which are compliance gaps. WHOIS data is unavailable due to privacy protection or query failure, but the website content and contact information indicate legitimacy. No critical vulnerabilities or suspicious content were detected. Overall, the site presents a professional and trustworthy front for a yoga institute but should improve privacy compliance and security headers to enhance trust and regulatory adherence.

15
35
17
40
57
75
100
yogaintegralyogayogainstitutecoimbatorewellness+3 more
WordPressGravity FormsBootstrapSwiper.js+4
2025-10-30T06:58:40.327Z