Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

150016
Websites
130
Industries
113
Countries
52
Avg Score
Page 177 of 527|Showing 8801-8850 of 26329
motork.io favicon

MotorK

motork.io

62
TransportationN/amediumMEDIUM

MotorK is a SaaS software provider specializing in automotive management solutions tailored for car dealers, distributors, and manufacturers. The company offers a comprehensive suite of products including dealership websites, CRM and lifecycle management, vehicle management, traffic acquisition, and e-reputation tools. Positioned as a digital transformation enabler in the automotive sector, MotorK targets industry professionals seeking to enhance customer journeys and operational efficiency. The website reflects a mature digital presence with strong SEO and structured data, indicating a well-established market position since at least 2019. Technically, the website is built on WordPress with Elementor and integrates modern marketing and analytics tools such as Google Tag Manager, Google Analytics, Mautic, and Iubenda for privacy compliance. The site is mobile-optimized and performs moderately well, with good accessibility and SEO practices. Security measures include HTTPS enforcement and Google reCAPTCHA on forms, alongside a comprehensive cookie consent mechanism. However, explicit security headers and dedicated security policies are absent, suggesting room for improvement in security posture. The security evaluation shows a solid baseline with no visible vulnerabilities or exposed sensitive data. Privacy compliance is robust with GDPR-aligned cookie consent and privacy policies. The absence of WHOIS data due to privacy protection is typical for commercial entities and does not detract from the site's legitimacy, which is supported by professional content and multiple trust signals. Overall, the site presents a low-risk profile with recommendations to enhance security headers and publish incident response information. Strategically, MotorK should focus on formalizing security policies, implementing vulnerability disclosure mechanisms, and enhancing accessibility to maintain trust and compliance as it scales. The digital infrastructure is sound but could benefit from continuous security audits and modernization to sustain competitive advantage and protect customer data.

45
73
35
75
-
85
100
saasautomotivecrmdigitalizationcardealers+4 more
WordPressElementorYoast SEOGoogle Tag Manager+3

Partner Domains:

investors.motork.io
subsidiary
2025-10-12T17:48:20.295Z
estewartandassociates.com favicon

E. Stewart & Associates

estewartandassociates.com

37
OtherUnited StatessmallHIGH

E. Stewart & Associates is a specialized fire prevention company operating primarily in Southern California, with over 30 years of experience. The company offers a range of environmental and fire prevention services including weed abatement, brush clearing, native habitat restoration, erosion control, and trail maintenance. Their clientele includes multiple municipalities, indicating a strong regional presence and trusted service provider status. The website reflects a professional and consistent brand image with clear contact information and service descriptions. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Flickity carousel, GSAP animations, and Vimeo for media integration. It is hosted by DreamHost, LLC, and uses HTTPS with a valid SSL certificate, ensuring secure communications. The site is moderately optimized for performance and mobile responsiveness, with good SEO practices evident in meta tags and structured data. From a security perspective, the site has a solid foundation with HTTPS and domain transfer protections but lacks advanced security headers and DNSSEC. There is no visible privacy policy or cookie consent mechanism, which presents compliance risks, especially under GDPR. No incident response or vulnerability disclosure information is provided, limiting transparency in security practices. Overall, the website is trustworthy and professional but would benefit from enhanced privacy compliance and security hardening to reduce risk and improve user trust. Strategic improvements in these areas would elevate the site's security posture and regulatory adherence.

15
50
17
40
-
75
20
firepreventionweedabatementbrushclearingcaliforniaenvironmentalservices+1 more
WordPressPHPjQueryFlickity carousel+3
2025-10-12T16:42:09.064Z
variablefontcourse.com favicon

Variable Font Course p/a Studio Dahm

variablefontcourse.com

43
EducationNetherlandssmallHIGH

Variable Font Course is a specialized educational platform offering an 11-lesson video course on creating and implementing variable color fonts, led by instructor Arthur Reinders Folmer of Typearture. The business operates under Studio Dahm, based in the Netherlands, targeting graphic designers, typographers, and creative coders globally. The website demonstrates a professional and consistent brand presence with rich content, testimonials, and structured FAQ, positioning itself as a niche leader in typography education. Technically, the site is built on WordPress with BuddyBoss and LearnDash LMS, integrating WooCommerce for e-commerce functionality. It uses modern web technologies and embeds Vimeo for video content, providing a good user experience with mobile optimization and SEO best practices. Security posture is solid with HTTPS and secure payment gateways, though it lacks some security headers and formal security policies. Privacy compliance is partial, missing explicit privacy and cookie policies, which is a notable gap. WHOIS data is unavailable, reducing domain trustworthiness, but the site content and business information are consistent and credible. Overall, the site scores well on content quality and business credibility but should improve privacy compliance and domain transparency.

30
35
2
60
42
80
20
educationvariablefontstypographyonlinecoursefontdesign
WordPressBuddyBoss PlatformWooCommerceLearnDash LMS+2

Partner Domains:

glyphsapp.com
partner
affinity.serif.com
partner

+2 more partners

2025-10-12T16:39:03.125Z
rmkinjurylaw.com favicon

The Law Office of Richard M. Kenny

rmkinjurylaw.com

70
OtherUnited StatessmallMEDIUM

The Law Office of Richard M. Kenny is a small, highly specialized personal injury law firm based in New York City, serving clients across multiple boroughs including Manhattan, Bronx, Brooklyn, Queens, and Nassau County. The firm emphasizes a client-focused approach with a strong track record of over $500 million recovered and more than 5,000 cases prepared for trial. Their services cover a broad range of personal injury and medical malpractice claims, positioning them as a top-rated legal service provider in the NYC market. Technically, the website is built on WordPress with modern plugins such as Gravity Forms for client intake and Yoast SEO for search optimization. The site demonstrates good mobile responsiveness, accessibility, and SEO practices. Security is well implemented with HTTPS and multiple security headers, though the absence of a visible cookie consent mechanism suggests room for improvement in privacy compliance. The security posture is solid with no detected vulnerabilities or exposed sensitive data. However, the lack of WHOIS data due to privacy protection slightly reduces transparency but is common for legal firms. Overall, the site is professional, trustworthy, and well-maintained, supporting the firm's market position. Strategically, the firm should enhance privacy compliance by implementing a cookie consent banner and consider publishing explicit security and incident response policies to further build client trust and meet regulatory requirements.

65
68
17
75
75
75
100
personalinjurylawyernyclegalservicesmedicalmalpractice+2 more
WordPressGravity FormsjQueryOwl Carousel+3
2025-10-12T15:34:51.341Z
martinezlawhouston.com favicon

The Martinez Law Firm - Houston DWI Lawyer

martinezlawhouston.com

57
OtherUnited StatessmallMEDIUM

The Martinez Law Firm is a specialized legal practice based in Houston, Texas, focusing on criminal defense and DWI cases. Led by attorney Herman Martinez, the firm boasts over 25 years of experience and a strong reputation in the Houston legal market. The firm targets individuals facing criminal charges in Houston and Harris County, offering personalized and client-driven legal services. Their market position is reinforced by numerous client testimonials, awards, and a high aggregate rating, positioning them as a trusted choice for criminal defense in the region. Technically, the website is built on WordPress using WPBakery Page Builder and NitroPack for performance optimization. It employs modern web technologies and is well-optimized for SEO and mobile devices, providing a fast and user-friendly experience. Security-wise, the site uses HTTPS with good SSL configuration but lacks some security headers and explicit security policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. WHOIS data is incomplete or unavailable, which slightly reduces domain trustworthiness, but the professional website and business signals mitigate this concern. Overall, the site demonstrates strong business credibility and technical maturity with room for improvement in privacy and security transparency.

15
58
2
70
52
75
100
lawyercriminaldefensedwihoustonlegalservices+1 more
WordPressWPBakery Page BuilderNitroPackGoogle Tag Manager+2
2025-10-12T15:34:06.226Z
davidhardawaylaw.com favicon

The Law Offices of David C. Hardaway

davidhardawaylaw.com

48
OtherUnited StatessmallHIGH

The Law Offices of David C. Hardaway is a specialized criminal defense law firm based in San Marcos, Texas, serving clients primarily in Hays County and surrounding Central Texas areas. The firm offers comprehensive legal defense services including DWI, drug crimes, violent crimes, and other serious criminal charges. The website is professionally designed with rich content, detailed FAQs, attorney profiles, case results, and client testimonials, positioning the firm as a reputable and trusted legal service provider in the region. The firm holds multiple industry recognitions and certifications, enhancing its market credibility. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery and Swiper.js, and uses Google Fonts and Google Tag Manager for analytics and tracking. The site employs HTTPS with good SSL configuration and includes spam protection via Google reCAPTCHA on its contact form. However, it lacks visible security headers and cookie consent mechanisms, which are recommended for improved security and privacy compliance. From a security perspective, the site shows good practices like HTTPS enforcement and no exposed sensitive data, but the absence of WHOIS data for the domain raises concerns about domain registration legitimacy. Despite this, the website content and structure strongly indicate a legitimate business operation. Overall, the site scores well on content quality, business credibility, and technical implementation but should address privacy compliance and security header improvements. Strategically, the firm should verify domain registration details, implement comprehensive privacy and cookie policies with consent mechanisms, and enhance security headers to strengthen trust and compliance. These improvements will support the firm's professional image and reduce potential risks related to privacy and security.

15
53
17
70
72
75
-
lawfirmcriminaldefensedwilawyersanmarcostexas+4 more
WordPressjQuerySwiper.jsGoogle Fonts+5

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:46.044Z
farmerclinecampbell.com favicon

Farmer, Cline & Campbell Personal Injury Lawyers

farmerclinecampbell.com

55
OtherUnited StatesmediumMEDIUM

Farmer, Cline & Campbell Personal Injury Lawyers is a well-established personal injury law firm based in Charleston, West Virginia, with nearly 30 years of experience and over 300 years of combined attorney experience. The firm specializes in a wide range of personal injury cases including vehicle accidents, catastrophic injuries, and wrongful death. They have a strong market position supported by numerous legal awards, certifications, and a large volume of positive client reviews. Their business model focuses on providing expert legal representation to injured individuals in West Virginia, offering free consultations and emphasizing client trust and success. Technically, the website is built on WordPress with modern performance optimizations such as NitroPack, and integrates popular tools like Gravity Forms and Google Analytics. The site is mobile-optimized, fast-loading, and professionally designed, providing an excellent user experience. Security posture is good with HTTPS and reCAPTCHA protections, though it lacks some advanced security headers and DNSSEC. Privacy compliance is limited due to the absence of explicit privacy and cookie policies. Overall, the website reflects a credible and professional legal service provider with strong business credibility but could improve privacy transparency and security hardening.

15
53
17
40
52
75
100
personalinjurylawyerlegalserviceswestvirginiacharleston+5 more
WordPressGravity FormsNitroPackGoogle Fonts+4
2025-10-12T15:33:41.008Z
fanninglawllc.com favicon

Fanning Law, LLC

fanninglawllc.com

54
OtherUnited StatessmallMEDIUM

Fanning Law, LLC is a well-established small law firm specializing in family law services in Southern Maryland, particularly La Plata and Charles County. Led by attorney William C. Fanning Jr., the firm offers comprehensive legal assistance in divorce, child custody, support, property division, and related family law matters, with additional practice areas in personal injury, criminal defense, and business law. The website reflects a professional and client-focused approach with detailed content, testimonials, and local expertise. Technically, the website is built on WordPress with modern libraries such as jQuery and Swiper, and integrates Google Fonts and Google Tag Manager for analytics. The site is mobile-optimized, accessible, and performs moderately well. Security measures include HTTPS and Google reCAPTCHA on forms, though security headers are not detected, and privacy compliance could be improved with explicit policies and cookie consent mechanisms. The security posture is solid with no visible vulnerabilities or exposed sensitive data, but the absence of WHOIS data and domain registration details introduces some uncertainty about domain legitimacy. However, the professional presentation and detailed business information mitigate these concerns. Overall, the site is trustworthy and serves its target audience effectively. Recommendations include enhancing privacy and cookie policies, implementing security headers, publishing incident response contacts, and regular security audits to maintain compliance and trust.

55
53
17
75
72
75
-
familylawdivorcelegalservicesmarylandlawyer+3 more
WordPressjQuery 3.7.1Swiper 6.5.4Google Fonts+2

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:20.723Z
mrlevelhead.com favicon

Mr. Level Head

mrlevelhead.com

49
OtherUnited StatessmallHIGH

Mr. Level Head is a small, local handyman and home repair service provider based in Spring Hill, Florida, serving Hernando and Pasco counties. The company offers a wide range of home repair services including door repair, electrical work, painting, drywall repair, furniture assembly, plumbing, and more. The website positions the business as reliable and detail-oriented, supported by multiple positive customer testimonials and local business listings such as BBB and Yelp. The business model is straightforward, charging by the job with flexible scheduling and a one-year labor warranty, targeting homeowners and residents in the local area. Technically, the website is built on WordPress using the Elementor page builder and related plugins, leveraging modern web technologies such as jQuery, Font Awesome, and Google Fonts. The site is hosted likely via GoDaddy, with a moderate performance profile and good mobile optimization. SEO is well addressed with proper meta tags, structured data (JSON-LD), and clear navigation. However, accessibility is basic and could be improved. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks advanced security headers and DNSSEC. No privacy or cookie policies are present, indicating compliance gaps especially regarding GDPR. There is no visible incident response or vulnerability disclosure information. Analytics and tracking are implemented via Google Analytics, Ahrefs, and StatCounter, with moderate user tracking levels but limited privacy transparency. Overall, the website is professional and trustworthy for its business purpose but would benefit from enhanced privacy compliance, improved security headers, and clearer policies to strengthen user trust and regulatory adherence.

15
35
17
55
72
80
40
handymanhomerepairlocalbusinessspringhillflhomeservices+1 more
WordPressElementorElementor ProjQuery+3
2025-10-12T15:32:50.656Z
sgfcitizen.org favicon

Springfield Daily Citizen

sgfcitizen.org

60
MediaUnited StatessmallMEDIUM

Springfield Daily Citizen is a local online newspaper serving the Springfield, Missouri community with community-focused news, event listings, and opinion pieces. Established in 2021, it operates as a small media outlet with a business model centered on digital news delivery supported by advertising and subscriptions. The website is professionally designed using WordPress with the Newspack theme and integrates multiple third-party services for analytics and advertising. The company maintains an active presence on major social media platforms, enhancing its community engagement and reach. Technically, the website leverages a modern CMS infrastructure with SEO optimization and mobile responsiveness. The hosting and domain registration are consistent with a legitimate local business, registered through GoDaddy. Performance is moderate with good mobile optimization, though there is room for improvement in accessibility and security headers. The site uses HTTPS with a good SSL configuration but lacks DNSSEC. From a security perspective, the site follows basic best practices such as HTTPS and no exposed sensitive data. However, it lacks published privacy and cookie policies, security headers, and a vulnerability disclosure mechanism, which are areas for improvement. The extensive use of tracking and advertising scripts indicates a moderate to extensive user tracking level, but privacy compliance is currently poor. Overall, Springfield Daily Citizen presents a trustworthy and professional local news platform with a solid technical foundation but requires enhancements in privacy compliance and security transparency to strengthen its security posture and user trust.

30
58
25
55
52
80
100
localnewsspringfieldmomediaonlinenewspapercommunitynews+2 more
WordPressYoast SEO pluginGoogle AnalyticsGoogle Tag Manager+7
2025-10-12T14:23:08.531Z
branco.com favicon

Branco Enterprises Inc.

branco.com

59
Real EstateUnited StatesmediumMEDIUM

Branco Enterprises Inc. is a well-established construction company operating primarily in the Midwest United States, with offices in Neosho and Springfield, Missouri. Founded in 1933, Branco offers a comprehensive range of construction services including general contracting, design-build, construction management, and pre-construction evaluations. The company positions itself as a leader in the regional construction industry, serving sectors such as education, healthcare, community, and commercial projects. Their website reflects a professional and modern digital presence, showcasing project portfolios, safety initiatives, and career opportunities. Technically, the site is built on WordPress with Elementor and integrates advanced tools such as Google Analytics, Google Maps API, and Facebook Pixel for marketing and analytics purposes. Security measures include HTTPS enforcement, reCAPTCHA on forms, and standard security headers, contributing to a strong security posture. However, the absence of a visible cookie consent mechanism and limited privacy compliance indicators suggest room for improvement in regulatory adherence. The WHOIS data for the domain is unavailable, likely due to privacy protection, which slightly reduces transparency but is common for businesses of this type. Overall, Branco Enterprises presents a credible and professional online presence with a solid foundation for further enhancing privacy and security compliance.

70
58
17
80
62
80
20
constructiongeneralcontractingdesign-buildmissouribrancoenterprises+4 more
WordPressElementorGravity FormsGoogle Maps API+3
2025-10-12T14:22:48.335Z
plusserver.com favicon

plusserver

plusserver.com

75
TechnologyGermanylargeMEDIUM

plusserver is a leading German cloud service provider specializing in managed cloud solutions, dedicated servers, and hybrid cloud offerings. The company targets business and enterprise customers seeking reliable cloud services hosted in German data centers. The website is professionally designed, primarily in German, and emphasizes compliance with GDPR and ISO 27001 certification, reinforcing its market position as a trustworthy cloud provider in Germany. Technically, the site is built on WordPress with Elementor and integrates modern marketing and analytics tools such as Google Tag Manager, Matomo, and HubSpot, reflecting a mature digital infrastructure. Security-wise, the website enforces HTTPS, implements key security headers, and uses a consent management platform to comply with privacy regulations. No critical vulnerabilities or exposed sensitive data were detected, though the absence of a public security.txt and explicit incident response contacts suggests room for improvement. The WHOIS data is unavailable, which is unusual but likely due to privacy protection, and while this introduces some uncertainty, the overall trust signals and professional presentation mitigate concerns. Strategic recommendations include publishing a security.txt file, enhancing incident response transparency, and improving accessibility features to further strengthen compliance and security posture.

70
70
60
60
72
85
100
cloudservicesgermancloudprovidermanagedhostinggdpriso27001
WordPressElementorYoast SEOGoogle Tag Manager+3
2025-10-12T14:21:03.059Z
tucowsdomains.com favicon

Tucows Domains Inc.

tucowsdomains.com

59
TechnologyCanadalargeMEDIUM

Tucows Domains Inc. operates a professional website providing domain registration and support services, including domain provider search and WHOIS lookup functionalities. The company is a well-established entity in the domain registration industry, backed by the parent company Tucows Inc. and its subsidiaries such as OpenSRS, Enom, Ascio, Hover, and Exact Hosting. The website targets domain owners and internet users seeking domain-related assistance, positioning itself as a trusted and ICANN-accredited registrar service provider. Technically, the website is built on WordPress CMS with modern JavaScript libraries including React, Backbone.js, and jQuery. It employs SEO best practices with Yoast SEO plugin and integrates marketing and analytics tools such as HubSpot and Google Tag Manager. The site is mobile-optimized and provides a good user experience with clear navigation and professional design. From a security perspective, the website uses HTTPS and implements reCAPTCHA on forms to prevent abuse. However, DNSSEC is not enabled, and no explicit security headers were detected, indicating room for improvement in DNS and HTTP security hardening. Privacy compliance is partial, with a privacy policy present but lacking a cookie consent mechanism, which may affect GDPR compliance. No incident response or vulnerability disclosure policies are publicly available. Overall, the website demonstrates a solid business credibility and technical foundation with moderate security posture. Strategic improvements in DNS security, privacy compliance, and security policy transparency would enhance trust and resilience against threats.

55
50
2
60
42
80
100
domainregistrationwhoislookupdomainprovidericannaccreditedtucows
WordPressYoast SEOjQueryBackbone.js+5

Partner Domains:

opensrs.com
subsidiary
www.enom.com
subsidiary

+3 more partners

2025-10-12T12:03:04.854Z