Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 16 of 19|Showing 751-800 of 903
profinas.lt favicon

UAB Profinas

profinas.lt

44
FinanceLithuaniasmallHIGH

Profinas is a Lithuanian financial services company specializing in outsourced accounting, financial consulting, and legal assistance tailored to support business growth. The company positions itself as a personal financial department alternative, offering a three-step accounting system designed to provide comprehensive financial management at the cost of an average accountant. Their website reflects a professional and consistent brand image, targeting Lithuanian businesses seeking reliable financial support. Technically, the website is built on WordPress 4.9.24 with common libraries such as jQuery and MediaElement.js, and integrates Google Tag Manager and Google Analytics for tracking. The site is mobile optimized and uses HTTPS with a cookie consent mechanism, indicating a moderate level of digital maturity. However, the WordPress version is outdated, which could pose security risks. From a security perspective, the site enforces HTTPS and includes a cookie consent banner, but lacks advanced security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were detected in the analysis. The absence of WHOIS data limits domain trust verification, but the website content and contact information suggest a legitimate and established business. Overall, Profinas demonstrates a solid business presence with good content quality and privacy compliance. Strategic improvements in security headers, CMS updates, and transparency around security policies would enhance their security posture and trustworthiness.

15
25
2
85
67
85
-
financeaccountingconsultingbusinessserviceslithuania
WordPress 4.9.24jQuery 1.12.4Google Tag ManagerGoogle Analytics+2
2025-06-24T16:45:10.400Z
grynumberhealth.com favicon

GryNumber Health LLC

grynumberhealth.com

53
HealthcareN/asmallMEDIUM

GryNumber Health LLC is a European healthcare company specializing in delivering innovative diagnostic and treatment solutions to underserved markets. As part of the GryNumber Health Group, the company focuses on facilitating access to novel medical technologies and therapies across 25+ small and medium-sized European countries. Their core services include healthcare innovation delivery, diagnostics, therapeutics, and market access support for global pharma innovators. The website reflects a professional and consistent brand presence with clear messaging targeting healthcare providers and pharmaceutical companies operating in Europe. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and Slider Revolution, leveraging Google Tag Manager for analytics and tracking. The site is mobile-optimized with good SEO and accessibility features, though some accessibility aspects could be improved. Performance is moderate, with external resources loaded from trusted CDNs. Security is enforced via HTTPS with domain transfer protections, but DNSSEC is not enabled and some security headers are missing. From a security perspective, the site demonstrates good baseline practices including GDPR-compliant cookie consent and privacy policies. However, it lacks explicit security policies, incident response contacts, and vulnerability disclosure mechanisms. No critical vulnerabilities or exposed sensitive data were detected. The WHOIS data is consistent with the business claims, showing a domain age appropriate for the company’s history. Overall, GryNumber Health’s website presents a credible, professional, and secure digital presence suitable for its healthcare innovation business. Strategic improvements in security headers, DNSSEC, and published security policies would enhance trust and compliance further.

15
80
2
85
62
75
20
healthcarediagnosticspharmaceuticalinnovationeuropeanmarkets+3 more
WordPressYoast SEO pluginjQueryMediaElement.js+4
2025-06-24T16:45:04.251Z
U

UAB Audėjas

audejas.lt

52
ManufacturingLithuaniamediumMEDIUM

UAB Audėjas is a well-established Lithuanian textile manufacturer specializing in upholstery and decorative fabrics since 1946. The company maintains a modern web presence with an e-shop and showcases its participation in EU co-financed projects, reflecting a commitment to innovation and competitiveness. The website is professionally designed, mobile-optimized, and provides clear contact channels and privacy compliance features, including GDPR-aligned policies and cookie consent mechanisms. Technically, the site employs a modern JavaScript stack including jQuery, Swiper.js, and Google reCAPTCHA for form security. While HTTPS is enforced, the absence of explicit security headers such as CSP and HSTS suggests room for improvement in hardening the security posture. The site demonstrates good SEO and accessibility basics but could enhance accessibility features further. Security-wise, the use of Google reCAPTCHA and cookie consent indicates awareness of bot mitigation and privacy regulations. However, the lack of published security policies or incident response contacts limits transparency. The WHOIS data is unavailable due to query limits, which slightly reduces trust but is likely privacy protection rather than malicious concealment. Overall, the website presents a credible and professional business with moderate technical maturity and good privacy compliance. Strategic improvements in security headers, incident response transparency, and WHOIS data availability would enhance trust and security posture.

65
68
2
70
72
60
-
textilesmanufacturingupholsterydecorativefabricseuprojects+3 more
jQuerySwiper.jsSelect2AOS (Animate On Scroll)+3
2025-06-24T16:45:03.898Z
privatuscare.com favicon

Privatus Care Solutions

privatuscare.com

57
HealthcareUnited StatesmediumMEDIUM

Privatus Care Solutions is a private nursing and home care service provider operating primarily in New England, New York, and Palm Beach, Florida. Established since 2005, the company offers a range of specialized healthcare services including post-operative care, dementia care, end-of-life care, medical escorts, and travel nursing. Their business model focuses on concierge-level, client-centered care managed by experienced registered nurses and senior managers. The website reflects a medium-sized healthcare business with a professional online presence and a clear focus on personalized home healthcare services. Technically, the website is built on WordPress with common plugins such as Yoast SEO and jQuery libraries. The site is moderately optimized for performance and mobile responsiveness, with good SEO practices evident through meta tags and structured data. However, accessibility features are basic, and there is room for improvement in security headers and cookie consent mechanisms. From a security perspective, the site enforces HTTPS and does not expose sensitive data or vulnerable libraries. However, the absence of security headers and a formal incident response or security policy page indicates moderate security maturity. The missing WHOIS data for the domain raises some concerns about domain registration transparency, which slightly impacts trustworthiness despite the professional appearance and social media presence. Overall, Privatus Care Solutions presents a credible and professional healthcare service website with good content quality and business credibility. Strategic improvements in privacy compliance, security headers, and domain transparency would enhance their security posture and trustworthiness further.

30
53
2
70
52
75
100
healthcareprivatenursinghomecarebostonnewyork+4 more
WordPressYoast SEOjQueryMediaElement.js
2025-06-24T16:45:00.410Z
asc-aqua.org favicon

Aquaculture Stewardship Council

asc-aqua.org

70
OtherN/amediumMEDIUM

The Aquaculture Stewardship Council (ASC) is a globally recognized non-profit organization dedicated to promoting responsible seafood farming through certification programs and sustainability standards. Their website serves multiple audiences including seafood consumers, producers, and business partners, providing comprehensive information about certification, impact, and engagement opportunities. The organization holds a strong market position as a leader in sustainable aquaculture certification with a medium-sized operational scale and a founding date consistent with domain registration in 2011. Technically, the website is built on a modern WordPress platform enhanced with React components and optimized for performance using WP Rocket. It employs various third-party tools such as Google Tag Manager and Visual Website Optimizer for analytics and marketing. The site demonstrates excellent design quality, mobile responsiveness, and SEO optimization, reflecting a mature digital presence. From a security perspective, the site enforces HTTPS and uses domain registration protections but lacks explicit security headers and published security policies or incident response contacts. No critical vulnerabilities or suspicious patterns were detected. Privacy compliance is partial, with a cookie consent mechanism present but no clear privacy policy page found in the provided content. Overall, the website is professional, trustworthy, and well-positioned in its sector but would benefit from enhanced transparency in privacy and security policies to improve compliance and user trust.

80
80
2
75
57
80
100
aquacultureseafoodsustainabilitycertificationnon-profit+2 more
WordPress 6.8.1jQueryReactLodash+5

Partner Domains:

be.asc-aqua.org
partner
cn.asc-aqua.org
partner

+3 more partners

2025-06-24T12:55:39.321Z
strandmeats.com favicon

Strand Palace Meats Ltd

strandmeats.com

39
RetailMaltasmallHIGH

Strand Palace Meats Ltd is a Malta-based company specializing in the import and export of meat and poultry products worldwide, with a focus on the European market. As a subdivision of Strand Palace Agencies, which has over 100 years of experience, the company leverages extensive supplier relationships globally to offer a wide range of products including beef, chicken, lamb, and pork. Their business model centers on sourcing quality products and providing competitive pricing to their clients. The website presents a professional image with clear product catalogues and contact information, targeting distributors and business partners in Europe. Technically, the website is built on WordPress 6.3 using WPBakery Page Builder and other modern web technologies. It is served over HTTPS with multimedia content and responsive design, providing a good user experience. However, some areas such as security headers and privacy compliance policies are lacking, which could be improved to enhance trust and regulatory adherence. From a security perspective, the site uses HTTPS and does not expose sensitive data or vulnerable libraries. Nonetheless, the absence of WHOIS registration data for the domain raises concerns about domain legitimacy and ownership transparency. No privacy or cookie policies were found, and no incident response or vulnerability disclosure information is provided, indicating gaps in compliance and security readiness. Overall, the website is functional and professional but would benefit from improved transparency in domain registration, enhanced security headers, and the addition of privacy and cookie policies to meet compliance standards and build greater trust with visitors and partners.

15
35
2
70
62
60
-
meatpoultrytradingmaltaimport+2 more
WordPress 6.3WPBakery Page BuilderLayerSliderjQuery 3.7.0+2
2025-06-24T09:30:12.636Z
johs-jensen.dk favicon

Johs. Jensen Fiske- & Muslingeeksport A/S

johs-jensen.dk

47
OtherDenmarksmallHIGH

Johs. Jensen Fiske- & Muslingeeksport A/S is a well-established Danish seafood exporter specializing in high-quality shellfish products sourced daily from Limfjorden. Founded in 1928, the company operates from Jegindø and maintains strong partnerships with local fishermen. Their product range includes blue mussels, line mussels, heart mussels, and lobsters, all certified for sustainability and organic standards. The website reflects a professional and consistent brand image with clear product and company information targeted at seafood buyers and distributors. Technically, the website is built on WordPress using the Enfold theme, incorporating modern web technologies such as jQuery, Google Fonts, and Google Maps API. The site is mobile-optimized and includes a cookie consent mechanism powered by Iubenda, demonstrating attention to privacy compliance. Performance is moderate, with room for improvement in accessibility and SEO. From a security perspective, the site uses HTTPS and a reputable cookie consent solution but lacks advanced security headers and DNSSEC. No incident response or vulnerability disclosure information is provided, which could be enhanced to improve security posture. The domain registration data aligns well with the company's history, supporting legitimacy. Overall, the website presents a trustworthy and professional digital presence with good privacy compliance and business credibility. Strategic improvements in security headers, incident response transparency, and technical performance could further strengthen the site’s security and user trust.

20
68
17
70
42
60
20
seafoodshellfishexportsustainabilitydenmark+5 more
WordPressEnfold ThemejQueryMediaElement.js+3

Partner Domains:

limfjordensfinest.dk
partner
2025-06-23T19:09:19.087Z
mitsubishi-motors-presse.fr favicon

M Motors Automobiles France

mitsubishi-motors-presse.fr

31
TransportationFrancemediumHIGH

Mitsubishi Motors Presse France operates an official press and media portal providing editorial content such as press releases, images, videos, and dossiers related to Mitsubishi Motors vehicles and corporate news. The site targets media professionals and journalists in France, serving as a trusted source for up-to-date information about Mitsubishi Motors' product lineup and corporate developments. The website is well-branded and consistent with Mitsubishi Motors' corporate identity, linking to official parent and partner sites. Technically, the site uses a mix of legacy and modern web technologies including jQuery 1.8.2, Google Analytics, and Dropbox API integrations. While the site is accessible over HTTPS and includes basic cookie consent mechanisms, it lacks explicit privacy and cookie policies and does not implement advanced security headers, which are recommended for improved security posture and compliance. The WHOIS data for the domain is unavailable, which slightly reduces trustworthiness but does not contradict the legitimacy of the site given the professional content and official branding. Overall, the site is functional, professional, and serves its purpose as a press resource effectively.

20
10
2
50
42
45
-
automotivepressmediamitsubishifrance+2 more
jQuery 1.8.2Google AnalyticsGoogle Tag ManagerDropbox API+4

Partner Domains:

www.mitsubishi-motors.fr
partner
www.mitsubishi-motors.com
parent
2025-06-23T11:07:18.660Z
hellotaste.ro favicon

Antena TV Group SA

hellotaste.ro

55
MediaRomanialargeMEDIUM

HelloTaste.ro is a Romanian culinary media website operated by Antena TV Group SA, a well-established media company with multiple TV channels and online platforms. The site offers a rich collection of recipes, cooking tips, interviews with chefs, and video content targeting Romanian-speaking audiences interested in gastronomy. The business model is primarily content publishing supported by advertising revenue, leveraging a strong brand presence within the Antena Group ecosystem. Technically, the website is built on WordPress and employs modern web technologies including Google Analytics, Prebid.js for programmatic advertising, and OneSignal for push notifications. The site is hosted on AWS infrastructure, uses HTTPS with good SSL configuration, and implements GDPR-compliant consent management via CookiePro. The site is mobile-optimized and SEO-friendly, with structured data enhancing search engine visibility. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and consent-based tracking. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not evident and should be implemented to strengthen security posture. No critical vulnerabilities or exposed sensitive data were detected. Privacy policies and terms of service are clearly presented, supporting compliance with GDPR. Overall, HelloTaste.ro presents a professional, trustworthy, and well-maintained online presence with a solid business backing. Strategic improvements in security headers and ongoing monitoring of third-party scripts are recommended to maintain and enhance security and compliance.

15
25
17
70
72
60
100
mediaculinaryrecipesadvertisinggdpr+2 more
WordPress 6.8.1Google FontsGoogle Analytics (gtag.js)Prebid.js for header bidding+6

Partner Domains:

catine.ro
partner
a1.ro
partner

+3 more partners

2025-06-23T10:18:39.287Z
millistream.com favicon

Millistream AB

millistream.com

58
FinanceSwedenmediumMEDIUM

Millistream AB is a Sweden-based financial market data provider established in 2008, specializing in delivering real-time and historical market data, news, and corporate information from major global exchanges such as Nasdaq, NYSE, Deutsche Börse, and London Stock Exchange. The company targets financial institutions including banks, brokers, asset managers, and media companies, primarily in the Nordic region but with growing international reach. Their offerings include APIs, widgets, and a web-based trading application called Millistream Trader, designed to provide efficient and intuitive market views. Technically, the website is built on WordPress with the Enfold theme and leverages modern web technologies including jQuery, Google Analytics, and custom streaming APIs. The infrastructure supports low-latency data delivery via dedicated leased lines and cloud presence on AWS, indicating a mature and scalable technical setup. The site is mobile optimized and SEO friendly, though performance is moderate. From a security perspective, the site uses HTTPS and implements GDPR-compliant cookie consent mechanisms. However, it lacks publicly available privacy policies, terms of service, security policies, and incident response contacts, which are important for compliance and trust. No critical vulnerabilities or exposed sensitive data were detected, but security headers are not explicitly present, and no vulnerability disclosure policy is found. Overall, Millistream presents a professional and credible online presence with solid business and technical foundations. To enhance trust and compliance, it is recommended to publish comprehensive privacy and security policies, provide clear contact channels for security incidents, and implement additional security headers and disclosure mechanisms.

45
65
2
70
90
70
40
financialdatamarketdataapiwidgetstrader+2 more
WordPress 6.8.1Enfold Theme 4.5.7Yoast SEO pluginjQuery 3.7.1+4
2025-06-23T10:14:05.126Z
optimx.com favicon

OptimX Markets, Inc.

optimx.com

61
FinanceUnited StatessmallMEDIUM

OptimX Markets, Inc. operates a technology platform focused on institutional block trading, aiming to enhance transparency and simplify liquidity sourcing for large suppliers and consumers. The company positions itself as an innovator in the finance technology sector, targeting institutional traders with solutions that align incentives and foster relationship-based trading dynamics. The website content reflects a professional and consistent brand image, emphasizing their key services and market approach. Technically, the website is built on WordPress using the Enfold theme and Jetpack plugin, incorporating modern web technologies such as jQuery and MediaElement.js. The site includes embedded Vimeo video content and Google Fonts, and it is served over HTTPS with a valid SSL certificate. Performance and mobile optimization are moderate to good, though accessibility features are basic. SEO practices are adequately implemented with proper meta tags and Open Graph data. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and does not provide a published security policy or incident response information. No vulnerability disclosure or security.txt file is present. Privacy compliance is partial, with a privacy policy found under regulatory disclosures but no cookie consent mechanism or terms of service page. Contact information is limited to an email address with no phone or physical address provided. Overall, the website demonstrates a solid business credibility and technical foundation but would benefit from enhanced privacy compliance and security transparency. Strategic recommendations include implementing cookie consent, publishing security and incident response policies, adding vulnerability disclosure mechanisms, and improving accessibility to strengthen trust and compliance.

30
50
25
70
49
85
100
financeinstitutionaltradingtechnologyliquidityblocktrading
WordPressjQueryMediaElement.jsVimeo embedded video+1
2025-06-22T18:40:32.617Z
openchip.com favicon

Openchip

openchip.com

60
TechnologySpainmediumMEDIUM

Openchip is a technology company specializing in the integration of in-house designed System on Chips (SoCs) and full-stack software solutions for AI and High-Performance Computing (HPC) applications. The company is recognized by the European Commission as an Important Project of Common European Interest (IPCEI), supporting research, innovation, and industrial deployment of microelectronics and communication technologies across the value chain. Openchip's key offerings include modular RISC-V based accelerator chips, advanced memory technologies, orchestration frameworks, and deployment-ready system designs, targeting European digital sovereignty and competitiveness. Technically, the website is built on WordPress using the Divi theme, with common plugins such as Contact Form 7 and Yoast SEO for optimization. The site demonstrates good mobile optimization and moderate performance, with appropriate SEO metadata and structured data enhancing its digital presence. Security-wise, the site enforces HTTPS and uses secure cookie settings but lacks advanced security headers and explicit security policies or incident response information. Overall, the security posture is solid but could be improved by implementing a security.txt file, enhancing security headers, and adding explicit GDPR-compliant consent mechanisms. The domain registration aligns with the company's location and business claims, indicating legitimacy. The site is professional and trustworthy, with clear business information and partner affiliations. Strategic recommendations include enhancing security and privacy compliance, publishing detailed security and incident response policies, and improving user consent mechanisms to strengthen trust and compliance.

15
50
33
70
57
75
100
technologyaihpcmicroelectronicseuropeancommission+1 more
WordPressDivi ThemejQueryMediaElement.js+3

Partner Domains:

gtd.es
partner
bsc.es
partner
2025-06-22T10:38:10.546Z
retailsolutions.ie favicon

Retail Solutions Ltd

retailsolutions.ie

39
RetailIrelandmediumHIGH

Retail Solutions Ltd is a well-established Irish company specializing in providing comprehensive EPOS (Electronic Point of Sale) systems tailored for retail sectors including convenience stores, supermarkets, forecourts, off-licences, pharmacies, and coffee shops. With over 25 years of market heritage and more than 2,000 businesses relying on their solutions, they offer a robust combination of hardware and software services designed to streamline retail operations, enhance customer experience, and integrate eCommerce platforms. Their website reflects a mature digital presence with detailed service descriptions, customer testimonials, and a professional design. Technically, the website is built on WordPress using the Elementor page builder and Astra theme, leveraging modern JavaScript libraries and marketing tools such as Google Tag Manager and ActiveDemand. The site is hosted likely on SiteGround, optimized for moderate performance and good mobile responsiveness. SEO and accessibility features are implemented at a good level, with structured data enhancing search engine understanding. From a security perspective, the site enforces HTTPS and employs cookie consent mechanisms compliant with GDPR, using Iubenda for privacy and cookie policies. While explicit security headers are not fully visible, no critical vulnerabilities or exposed sensitive data were detected. The domain registration details align well with the business claims, indicating legitimacy and consistency. Overall, Retail Solutions Ltd demonstrates a strong business and technical foundation with good security and privacy practices. Strategic recommendations include enhancing security headers, publishing explicit security policies, and continuous monitoring of third-party scripts to maintain a robust security posture.

15
43
13
85
-
65
-
pointofsaleepossystemretailpossystemecommerceintegration+3 more
WordPressElementorPHPjQuery+5

Partner Domains:

hapi.ie
partner
2025-06-22T09:00:05.985Z
P

PaceMetrics

pacemetrics.com

42
FinanceIrelandsmallHIGH

PaceMetrics is a specialized data management company focused on serving financial services businesses by providing solutions that enhance data quality, automate processes, reduce risk, and improve operational efficiency. Their product suite includes Assure, PaceMaker, PVS, and bespoke training programs through their sister company Intuition Publishing. The company positions itself as a trusted partner for financial institutions, demonstrated by client logos from major banks and financial firms. Technically, the website is built on WordPress using modern plugins and frameworks such as WPBakery, LayerSlider, and Revolution Slider. The site is mobile-optimized with good SEO practices and uses Google Analytics for user tracking. However, some security best practices like security headers and privacy policies are missing or not publicly visible. From a security perspective, the site enforces HTTPS and uses spam protection plugins but lacks visible security headers and incident response information. No critical vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy compliance is weak due to the absence of privacy and cookie policies and consent mechanisms. Overall, the website is professional and credible with strong business indicators but would benefit from enhanced privacy compliance and security hardening to improve trust and regulatory adherence.

30
10
-
60
-
60
100
datamanagementfinancialservicesdataqualityriskmanagementtraining+1 more
jQueryLayerSliderRevolution SliderGravity Forms (implied by gform_wrapper CSS)+3
2025-06-22T09:00:05.071Z
daxten.com favicon

DAXTEN Ltd

daxten.com

49
EnergyUnited KingdommediumHIGH

Daxten Ltd is a well-established UK-based company specializing in data centre optimisation solutions, including power distribution, cooling optimisation, monitoring, and infrastructure services. With a history dating back to 1994, Daxten positions itself as an expert in delivering smart, efficient, and secure data centre products and services to professional and enterprise clients. The website reflects a mature digital presence with comprehensive product catalogs and clear contact channels. Technically, the website is built on WordPress using the Divi theme and several plugins such as Divi Pixel and Borlabs Cookie for enhanced functionality and compliance. The site is mobile-optimized, SEO-friendly, and uses modern web technologies, ensuring a good user experience and performance. Security practices include HTTPS enforcement and cookie consent mechanisms, though additional security headers could enhance the posture further. The security posture is solid with no visible vulnerabilities or exposed sensitive data. Privacy compliance is strong, with clear privacy and cookie policies and consent mechanisms in place. Business credibility is supported by transparent contact information, legal disclosures, and consistent branding. Overall, Daxten's website demonstrates a professional, secure, and compliant online presence suitable for its target market. Strategic recommendations include enhancing security headers, publishing explicit security policies, and continuous monitoring of third-party components to maintain security and compliance.

50
43
-
85
-
85
40
datacentredatacenterexpertdatacenteroptimisationpowerdistributioncoolingoptimisation+2 more
WordPressDivi ThemejQueryDivi Pixel Plugin+2
2025-06-22T09:00:04.001Z
accreda.eu favicon

Accreda Ltd

accreda.eu

54
TechnologyMaltamediumMEDIUM

Accreda Ltd is a Malta and UK based technology company specializing in ERP systems, web-based solutions, and ICT consultancy services. Positioned as a leader in Malta for enterprise-level software solutions, Accreda offers a comprehensive suite of services including Microsoft Dynamics NAV/365 Business Central ERP, technical consultancy, blockchain collaboration, and technology support services. Their target audience includes businesses across various sectors such as remote gaming, manufacturing, retail, and professional services seeking integrated and customized IT solutions. The company emphasizes customer satisfaction and technical expertise, supported by their Microsoft partnership and a strong digital presence. Technically, the website is built on WordPress with modern plugins such as WPBakery Page Builder, Contact Form 7, and Yoast SEO, hosted likely on WPEngine. The site demonstrates good mobile optimization, SEO practices, and uses Google reCAPTCHA for form security. Cookie consent is actively managed through a compliant banner and scripts, reflecting a mature approach to privacy compliance. From a security perspective, the site enforces HTTPS and employs Google reCAPTCHA on forms, but lacks visible advanced security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were detected in the HTML content. The WHOIS data aligns with the business claims, showing consistent registration details and domain age appropriate for the company's history. Overall, Accreda presents a professional and trustworthy online presence with good technical and privacy compliance maturity. Strategic improvements could focus on enhancing security headers, publishing formal security policies, and expanding incident response transparency to further strengthen their security posture and trustworthiness.

15
15
43
85
-
90
100
erpictconsultancywebsolutionsmaltamicrosoftpartner+2 more
WordPressPHPjQueryGoogle reCAPTCHA+5
2025-06-21T18:22:02.946Z
ownersbest.com.mt favicon

Owners Best

ownersbest.com.mt

44
Real EstateMaltamediumHIGH

Owners Best is a Malta-based real estate network established in 2003, specializing in property sales and listings across Malta. The website serves as a comprehensive platform for property buyers and sellers, offering detailed listings, property guides, and career opportunities. It holds a strong market position as a leading property network in Malta, targeting local and international property seekers. The business model revolves around brokerage and advertising services for real estate, with a focus on user-friendly search and listing capabilities. Technically, the website is built on WordPress using popular plugins such as WPBakery Page Builder and Yoast SEO, ensuring good SEO and content management capabilities. The site uses modern web technologies including Bootstrap for responsive design and FontAwesome for icons. Performance is moderate with good mobile optimization and basic accessibility features. Analytics and marketing tools include Google Tag Manager, Facebook Pixel, and Jetpack Stats, enabling moderate user tracking and marketing insights. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, aligning with GDPR requirements. However, it lacks explicit security headers such as Content-Security-Policy and HSTS, which could enhance protection against common web attacks. No incident response or vulnerability disclosure policies are publicly available, indicating room for improvement in security transparency and readiness. Overall, the website is professional, trustworthy, and well-aligned with its business goals. The domain registration details are consistent with the business claims, supporting legitimacy. Strategic recommendations include enhancing security headers, publishing security and incident response policies, and improving accessibility compliance to strengthen the site's security posture and user trust.

15
18
-
60
-
80
100
realestatepropertymaltawordpressseo+2 more
WordPressPHPjQueryBootstrap+4

Partner Domains:

niu.com.mt
partner
2025-06-21T18:22:00.323Z