Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 116 of 151|Showing 5751-5800 of 7505
fundnav.lu favicon

Fundnav Login

fundnav.lu

53
FinanceLuxembourgsmallMEDIUM

Fundnav.lu operates as a secure login portal primarily targeting professional investors and approved users who have undergone KYC verification by fund managers or issuers. The platform facilitates access to fund and security information, emphasizing compliance and restricting access to unauthorized or US persons. The website content is minimal but focused on secure access and legal disclaimers, reflecting a niche financial services business model. The site is consistent with a small Luxembourg-based finance entity founded around 2012. Technically, the website employs standard web technologies including HTML5, CSS3, JavaScript, jQuery, and FontAwesome. Hosting is managed via EuroDNS nameservers, indicating a reputable DNS provider. The site demonstrates basic mobile optimization and accessibility but lacks advanced SEO and security headers. No analytics or tracking scripts were detected, suggesting minimal user tracking. From a security perspective, the site uses HTTPS (implied by form action URL), but no explicit security headers such as CSP or HSTS were found. The login form requires credentials but lacks visible anti-CSRF tokens. No incident response or security policies are published. The WHOIS data is consistent and transparent, supporting legitimacy. No WAF or blocking mechanisms were detected, and the content is accessible. Overall, Fundnav.lu presents a moderate risk profile with a need for improved privacy compliance, enhanced security headers, and more comprehensive contact information. The business credibility is solid given the domain age and consistent WHOIS data, but technical and privacy improvements would strengthen trust and security posture.

-
10
17
85
72
75
100
financeinvestmentfundsloginprofessionalinvestors+1 more
HTML5CSS3JavaScriptjQuery+1
2025-07-07T18:13:58.242Z
myfilerunner.com favicon

MyFileRunner

myfilerunner.com

56
TechnologyUnited StatessmallMEDIUM

MyFileRunner is a specialized legal technology service provider offering secure and accurate eFiling solutions primarily targeting law firms in Texas, Illinois, and California. The company provides both full-service and self-service eFiling options, along with additional services such as eService, reporting, corporate billing, and case management integration. Positioned as a top-rated service with 24/7 expert support, MyFileRunner aims to streamline legal filing processes and improve law firm efficiency. The website is built on a mature WordPress infrastructure enhanced with modern plugins and performance optimizations like NitroPack. The technical setup includes integration with Google reCAPTCHA v3 for form security and AWS-based hosting inferred from DNS records. The site demonstrates good mobile optimization, SEO practices, and accessibility at a basic level. From a security perspective, the site enforces HTTPS with strong domain locking via registrar status flags, though DNSSEC is not enabled. No explicit security or incident response policies are published, which is a gap in transparency. Privacy and cookie policies are present with a consent mechanism, but GDPR compliance indicators are minimal. Overall, the security posture is solid but could be improved with additional policy disclosures and DNSSEC. The domain is well aged (since 2003) and registered with GoDaddy without privacy protection, consistent with a legitimate business. Contact information is clear and professional, including toll-free and local phone numbers, a physical address in Texas, and a company support email. No suspicious or malicious indicators were found. Strategic recommendations include enabling DNSSEC, publishing security and incident response policies, and adding terms of service to enhance legal clarity and trust.

15
53
2
60
52
80
100
legalefilinglawfirmslegalservicestechnology+1 more
WordPressWPBakery Page BuilderUltimate VC AddonsNitroPack optimization+3
2025-07-07T17:01:27.184Z
facct.com favicon

Florida Alliance of Children's Councils & Trusts

facct.com

58
GovernmentUnited StatessmallMEDIUM

The Florida Alliance of Children's Councils & Trusts (FACCT) is a well-established non-profit organization founded in 2004, dedicated to supporting children’s services councils and trusts across Florida. The organization focuses on advocacy, public policy, and statewide initiatives to improve the health, education, and well-being of children and families. FACCT operates as a membership-based alliance, providing resources, policy shaping, and leadership to its members and stakeholders. Technically, the website is built on WordPress using the Elementor page builder, incorporating modern web technologies such as jQuery, Google Fonts, and FontAwesome. The site is hosted likely via GoDaddy, with a domain registered since 2004, indicating a mature digital presence. The website is mobile-optimized with good navigation and content relevance, though some accessibility features could be enhanced. From a security perspective, the site uses HTTPS with a valid SSL certificate and domain status protections. However, it lacks DNSSEC and security headers, which are recommended to improve security posture. No vulnerability disclosure or incident response information is provided, and cookie consent mechanisms are absent, indicating room for improvement in privacy compliance. Overall, FACCT’s website is professional, trustworthy, and serves its target audience effectively. Strategic improvements in security headers, privacy compliance, and vulnerability disclosure would enhance its security and regulatory posture, supporting its mission and stakeholder trust.

15
53
17
55
62
80
100
non-profitchildrenadvocacyfloridapublicpolicy+3 more
WordPressElementorPHPjQuery+2
2025-07-07T17:00:26.996Z
filetime.com favicon

Themis Solutions (USA) Inc.

filetime.com

63
TechnologyUnited StatessmallMEDIUM

FileTime, operated by Themis Solutions (USA) Inc., is a specialized eFiling service provider catering primarily to law firms and legal professionals in Texas, California, Illinois, and Indiana. The company offers a suite of services including free e-Filing, document conversion, customizable reporting, monthly invoicing, and extended document storage, emphasizing ease of use and strong customer support. The website reflects a focused business model targeting legal professionals requiring efficient court filing solutions without contracts or sign-up fees. Technically, the website employs a modern technology stack including jQuery, Bootstrap, and Kendo UI, with hosting likely supported by Google Cloud DNS and DNS Made Easy. The site is mobile-optimized with good navigation and professional design, although some accessibility features are basic. Performance is moderate, and SEO practices are adequately implemented. However, no common CMS is detected, indicating a custom or proprietary platform. From a security perspective, the site uses HTTPS and has domain transfer protections in place, but lacks DNSSEC and visible security headers, which are recommended for enhanced security. No privacy or cookie policies are present, representing compliance gaps especially under GDPR. Incident response and security policy information are not publicly disclosed, limiting transparency. The domain's WHOIS data shows a long registration history consistent with the business age, supporting legitimacy. Overall, FileTime presents a trustworthy and professional online presence with strong business credibility and technical implementation. However, improvements in privacy compliance and security best practices are advised to enhance user trust and regulatory adherence.

70
35
17
70
67
70
100
efilinglegalservicescourtfilingdocumentmanagementcustomersupport
jQueryBootstrapKendo UIFontAwesome+2
2025-07-07T12:26:06.090Z
joryand.co favicon

Jory&Co.

joryand.co

49
OtherUnited KingdomsmallHIGH

Jory&Co is a UK-based global design studio specializing in creative services that drive social and environmental change. Founded in 2015, the company positions itself as a niche player focusing on visionary clients who seek impactful branding and digital design solutions. Their service offerings include brand design, impact report design, and infographics, targeting organizations committed to sustainability and positive change. The website reflects a professional and consistent brand image with excellent content quality and user experience. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Google Analytics, Google Tag Manager, Hotjar, and Vimeo for multimedia content. The site is hosted with a CDN provider, ensuring fast performance and excellent mobile optimization. Accessibility features and SEO best practices are well implemented, contributing to a strong digital presence. From a security perspective, the site enforces HTTPS and employs cookie consent mechanisms compliant with GDPR. While some security headers are not explicitly detected, no vulnerabilities or exposed sensitive data were found. The use of reCAPTCHA on forms enhances protection against automated abuse. However, the absence of a published security policy or incident response contact is noted. Overall, the website demonstrates a high level of professionalism, security awareness, and privacy compliance. The domain registration is privacy protected but consistent with the business profile, and no suspicious indicators were found. Strategic recommendations include enhancing security headers, publishing security and incident response policies, and considering a vulnerability disclosure program to further strengthen trust and security posture.

30
65
2
40
72
75
20
designsustainabilitybrandingimpactcreativeagency+1 more
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+7
2025-07-07T11:16:02.704Z
shopify1percent.com favicon

Shopify1Percent

shopify1percent.com

57
E-commerceN/asmallMEDIUM

Shopify1Percent is a niche podcast website dedicated to providing Shopify merchants with actionable tips, growth hacks, and expert interviews to help improve their e-commerce businesses. The site is hosted on the Podpage platform and integrates with major podcast distribution channels such as Apple Podcasts, Spotify, Amazon Music, Audible, YouTube, and iHeartRadio, indicating a well-established presence in the podcasting ecosystem. The content is professionally presented with a consistent brand identity and targets Shopify store owners seeking to grow their sales and business acumen. Technically, the website employs modern web technologies including Bootstrap, FontAwesome, Swiper.js, and Google Fonts, with lazy loading for images and embedded YouTube videos for enhanced user experience. Google Analytics and Google Tag Manager are used for visitor tracking and analytics. The site is mobile optimized and demonstrates good SEO practices with appropriate meta tags and Open Graph data. However, no explicit hosting provider or CMS beyond Podpage is identified. From a security perspective, the site uses HTTPS with a presumably strong SSL configuration, but lacks visible security headers such as Content-Security-Policy or X-Frame-Options. There is no evidence of privacy or cookie policies, nor consent mechanisms, which is a compliance gap especially for GDPR. The WHOIS data is unavailable, which raises questions about domain registration legitimacy, though the active and professional site presence suggests possible privacy protection or proxy registration. Overall, Shopify1Percent presents a credible and professionally maintained podcast site with good technical implementation and content quality. The main risks lie in the lack of visible privacy and cookie policies and the absence of WHOIS transparency. Addressing these gaps would improve compliance and trustworthiness.

55
50
2
70
52
55
100
shopifypodcaste-commerceshopifypodcastshopifygrowth+1 more
Bootstrap CSSFontAwesomeSwiper.jsGoogle Fonts (DM Sans, Teko, Asap)+5
2025-07-07T11:15:32.602Z
staystifree.org.au favicon

Alfred Health Victoria

staystifree.org.au

59
HealthcareAustraliamediumMEDIUM

StaySTIFree is a Victorian Sexual Health Network initiative operated under Alfred Health Victoria, providing comprehensive sexual health education and resources focused on STI prevention, testing, and treatment. The website serves as a trusted regional platform offering symptom urgency assessments, testing guidance, and a locator for testing services, targeting the general public in Victoria, Australia. The site is affiliated with reputable health organizations, enhancing its credibility and trustworthiness. Technically, the website employs a modern technology stack including Mapbox for mapping, Google Tag Manager, Facebook and TikTok tracking pixels, and ShareThis for social sharing. It is built on the ExpressionEngine CMS and demonstrates good mobile optimization, accessibility, and SEO practices. Performance is moderate with no major technical issues detected. From a security perspective, the site enforces HTTPS and uses CSRF tokens in forms, but lacks some recommended security headers and a cookie consent mechanism. No vulnerabilities or exposed sensitive data were found. Privacy compliance is basic with a privacy policy present but no explicit GDPR cookie consent. Contact information is limited to a contact form without direct emails or phone numbers. Overall, the website presents a low-risk profile with strong business credibility and good technical implementation. Strategic improvements include enhancing privacy compliance with cookie consent, adding security headers, and publishing security and incident response policies to further strengthen trust and security posture.

30
53
2
50
72
80
100
sexualhealthstipreventionhealtheducationvictoriaaustraliapublichealth+1 more
Mapbox GL JSGoogle Tag ManagerFacebook PixelTikTok Pixel+5

Partner Domains:

www.alfredhealth.org.au
partner
www.mshc.org.au
partner

+3 more partners

2025-07-07T11:14:27.407Z
alfredresearchalliance.org.au favicon

Alfred Research Alliance

alfredresearchalliance.org.au

53
HealthcareAustraliamediumMEDIUM

The Alfred Research Alliance is a collaborative partnership of leading health research and education organizations based in Melbourne, Australia. The alliance focuses on advancing biomedical, translational, clinical, and public health research to address critical health challenges. Their website reflects a professional and well-structured digital presence, targeting researchers, clinicians, students, and the broader healthcare community. The alliance's market position is strong within the Australian healthcare research sector, supported by reputable member institutions. Technically, the website employs modern web technologies including Google Tag Manager for analytics, FontAwesome icons, and Google Fonts for typography. The site is mobile-optimized with responsive design and good accessibility features. The CMS appears to be ExpressionEngine based on form tokens and hidden fields. Performance is moderate with no major technical issues detected. From a security perspective, the site enforces HTTPS and uses CSRF tokens in forms, indicating good baseline security practices. However, the absence of key security headers and a visible security or incident response policy reduces the overall security posture. The malformed WHOIS data limits domain trust verification, though the professional content and partner links support legitimacy. Privacy compliance is basic, lacking a cookie consent mechanism despite tracking scripts. Overall, the Alfred Research Alliance website is a credible and professional platform with solid content and technical implementation. Strategic improvements in privacy compliance, security headers, and WHOIS transparency would enhance trust and security posture further.

30
53
2
70
-
85
100
healthcareresearcheducationclinicaltrialsbiomedical+1 more
Google Tag ManagerFontAwesomeGoogle Fonts (Roboto)JavaScript+2

Partner Domains:

www.alfredhealth.org.au
partner
www.monash.edu
partner

+3 more partners

2025-07-07T10:11:57.130Z
arteria.fr favicon

Arteria

arteria.fr

47
EnergyFrancemediumHIGH

Arteria is a French company specializing in providing fiber optic infrastructure and hosting services by leveraging the electricity transport network managed by its parent company, RTE. The company offers dark fiber, activated fiber, mobile antenna hosting on electrical pylons, and hosting solutions tailored for edge cloud and regional data centers. Positioned as a key regional infrastructure provider, Arteria targets telecommunications operators and businesses requiring high bandwidth connectivity. The website reflects a professional and consistent brand image with clear service offerings and a focus on connecting territories through advanced fiber optic technologies. Technically, the site is built on WordPress with modern plugins such as Yoast SEO and Google Site Kit, ensuring good SEO and analytics integration. The site is mobile-optimized and performs moderately well, though some accessibility features could be improved. Security posture is solid with HTTPS enforced and cookie consent implemented, but lacks explicit security policies and incident response information. Overall, the domain registration data aligns well with the business history and legitimacy, supporting a high trust level. Strategic recommendations include enhancing security transparency and adding incident response contacts to improve trust and compliance.

30
25
10
85
95
50
-
fiberopticenergytelecommunicationsinfrastructurefrance+3 more
WordPress 6.8.1Yoast SEO pluginWPBakery Page BuilderGoogle Site Kit+5

Partner Domains:

rte-france.com
parent
2025-07-07T10:10:16.716Z
klopp.law favicon

Klopp Law

klopp.law

53
OtherUnited StatessmallMEDIUM

Klopp Law is a veteran-owned criminal defense law firm based in Reading, Pennsylvania, specializing in defending clients against serious criminal charges such as drug offenses, gun cases, assaults, and DUI. The firm positions itself as a dedicated and aggressive advocate for clients in eastern Pennsylvania, emphasizing personalized legal representation and thorough case preparation. The website reflects a small but professional legal practice with a clear focus on criminal defense services. Technically, the website is built on WordPress using the PaperStreet theme framework, incorporating modern web technologies such as jQuery, Swiper.js for sliders, and lazy loading for images. SEO is well addressed with Yoast SEO plugin integration and proper meta tags. The site is mobile optimized and provides a good user experience with clear navigation and professional design. Hosting is likely through GoDaddy, consistent with the domain registrar information. From a security perspective, the site uses HTTPS and does not expose sensitive data in the HTML. However, it lacks DNSSEC, visible security headers, and dedicated security or incident response policies. Privacy compliance is weak due to the absence of privacy and cookie policies or consent mechanisms. The domain WHOIS data is consistent with the business claims, showing no privacy protection and a legitimate registration history. Overall, Klopp Law's website is a solid representation of a small legal practice with good business credibility and technical implementation but requires improvements in privacy compliance and security best practices to enhance trust and regulatory adherence.

15
35
2
70
52
75
100
legalcriminaldefenselawfirmpennsylvaniaveteran-owned+1 more
WordPressYoast SEO pluginjQuerySwiper.js+3

Partner Domains:

clients.clio.com
partner
app.clio.com
partner

+2 more partners

2025-07-07T10:08:46.369Z
mgwl.com favicon

McGill Gotsdiner Workman & Lepp P.C. L.L.O.

mgwl.com

57
OtherUnited StatesmediumMEDIUM

McGill Gotsdiner Workman & Lepp P.C. L.L.O. is a well-established Nebraska-based law firm specializing in corporate, business, estate planning, health care, employment, litigation, and real estate legal services. The firm targets entrepreneurs and businesses seeking comprehensive legal counsel and has been operating since 1975, positioning itself as a trusted regional legal service provider. The website reflects a professional and client-focused approach with detailed attorney profiles and multiple practice areas. Technically, the site is built on WordPress and leverages modern web technologies including Google Analytics, Google Tag Manager, and reCAPTCHA for security on contact forms. The site is mobile optimized and demonstrates good SEO practices with structured data markup. Security posture is solid with HTTPS enforced and use of CAPTCHA, though explicit security headers are not detected, and privacy compliance could be improved with cookie consent mechanisms. The absence of WHOIS registration data is a notable inconsistency that slightly impacts trust but does not overshadow the professional presentation and content quality. Overall, the website is a credible digital presence for a mid-sized law firm with room for enhancement in privacy and security transparency.

15
35
17
75
52
80
100
lawlegalcorporatebusinessestateplanning+5 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle reCAPTCHA v3+2

Partner Domains:

www.lawfirmessentials.com
partner
www.paperstreet.com
partner
2025-07-07T10:08:41.355Z
crossandsmith.com favicon

Cross & Smith LLC

crossandsmith.com

55
OtherUnited StatessmallMEDIUM

Cross & Smith LLC is a well-established personal injury law firm operating primarily in Alabama with offices in Tuscaloosa and Birmingham. The firm specializes in accident and injury cases, boasting over 25 years of experience and significant verdicts and settlements exceeding $150 million. Their business model is client-focused with a contingency fee structure, targeting individuals seeking legal representation for personal injury matters. The website reflects a professional and consistent brand image with comprehensive service descriptions and client testimonials, supporting a strong market position in the regional legal services sector. Technically, the website is built on WordPress using a custom theme by PaperStreet, incorporating modern web technologies such as Yoast SEO for search optimization, Google reCAPTCHA for form security, and CallRail for call tracking. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. However, some accessibility features are basic and there is room for improvement in performance and security headers. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms from spam. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of explicit security headers like HSTS and CSP, and the lack of a published security or incident response policy, indicate areas for enhancement. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism or GDPR-specific disclosures. Overall, the website is trustworthy and professional, with a solid business credibility score. Strategic improvements in privacy compliance, security header implementation, and incident response transparency would further strengthen the firm's digital security posture and regulatory adherence.

15
35
17
70
42
75
100
personalinjurylawfirmlegalservicesalabamaattorneys+2 more
WordPressYoast SEOFontAwesomeGoogle reCAPTCHA+2
2025-07-07T10:08:16.290Z
randallmckinneylaw.com favicon

Law Office Randall H. McKinney

randallmckinneylaw.com

54
OtherN/asmallMEDIUM

The Law Office Randall H. McKinney operates as a small legal services provider specializing in trial law and personal injury cases in the Pittsburgh area. The website presents a professional image with clear navigation and detailed practice areas, targeting individuals seeking legal representation in personal injury and criminal defense matters. The business model is focused on providing specialized legal counsel with a local market position. Technically, the website employs common web technologies including Google Analytics and Google Tag Manager for tracking, and uses modern JavaScript libraries for UI elements. The site is moderately optimized for performance and mobile devices, with good SEO practices evident. However, no CMS or hosting provider information is discernible from the data. From a security perspective, the site uses HTTPS and avoids exposing sensitive data, but lacks visible security headers and does not provide privacy or cookie policies, which are important for compliance and user trust. The absence of WHOIS registration data is a notable concern, potentially indicating privacy protection or data unavailability, which impacts domain legitimacy assessment. Overall, the security posture is moderate but could be improved with better policy disclosures and security headers. The overall risk is moderate with recommendations to enhance privacy compliance, implement security best practices, and clarify domain registration details to improve trustworthiness and regulatory adherence.

20
35
2
70
77
60
100
legallawyerpersonalinjurytriallawyerpittsburgh+1 more
Google AnalyticsGoogle Tag ManagerFontAwesome
2025-07-07T10:07:31.117Z
salazar.law favicon

Salazar Law

salazar.law

57
FinanceUnited StatessmallMEDIUM

Salazar Law is a specialized boutique law firm based in Miami, Florida, focusing on high-stakes financial restructuring, litigation, cryptocurrency-related legal challenges, and government investigations. The firm has a strong market position with over $1 billion in judgments and settlements and over $10 billion in debt restructured, serving businesses and individuals with complex legal needs. Their key services include strategic restructuring, high-stakes litigation, and cryptocurrency litigation and recovery. The website reflects a professional and consistent brand image targeting business clients in the finance and legal sectors. Technically, the website employs modern web technologies including Google Analytics, Google Tag Manager, Google reCAPTCHA, and the Foundation CSS framework. The site is mobile optimized with good navigation and SEO practices, though performance is moderate. Security posture is solid with HTTPS enforced and use of reCAPTCHA, but lacks some security headers and explicit privacy and cookie policies, which are areas for improvement. From a security perspective, the site shows no critical vulnerabilities or exposed sensitive data. However, the absence of privacy and cookie policies and incident response information indicates compliance gaps. The WHOIS data is unavailable, likely due to privacy protection, which is common and justified for law firms. Overall, the site is trustworthy and professional but would benefit from enhanced transparency and security best practices. Strategically, the firm should prioritize publishing comprehensive privacy and cookie policies, implement security headers, and provide incident response and vulnerability disclosure information to strengthen compliance and trust. Enhancing accessibility and performance would further improve user experience and SEO effectiveness.

30
35
2
70
67
70
100
lawlegalfinancialrestructuringlitigationcryptocurrency+2 more
Google AnalyticsGoogle Tag ManagerGoogle reCAPTCHAjQuery+2

Partner Domains:

secure.lawpay.com
partner
www.lawfirmessentials.com
partner

+1 more partners

2025-07-07T10:07:05.970Z
ganspoel.be favicon

Centrum Ganspoel vzw

ganspoel.be

57
EducationBelgiummediumMEDIUM

Centrum Ganspoel vzw is a well-established non-profit organization based in Belgium, specializing in education and care for children, youth, and adults with visual and multiple disabilities. The organization offers specialized primary education, warm and tailored care, and professional support both on campus and in the community. Their market position is strong within their niche, supported by a professional website that clearly communicates their services and values. Technically, the website is built on a mature ASP.NET Web Forms platform with Telerik UI components and integrates modern web technologies such as Bootstrap and FontAwesome. It employs Google Analytics for visitor tracking and implements cookie consent mechanisms, reflecting a moderate to good level of digital maturity. The site is mobile-optimized and accessible, with good SEO practices. From a security perspective, the site uses HTTPS and has implemented cookie consent, but lacks explicit security headers and publicly available security policies or incident response information. No critical vulnerabilities or exposed sensitive data were detected. The WHOIS data is restricted, which is common for privacy reasons, but the website's professional presentation and trust signals mitigate concerns. Overall, the website presents a low-risk profile with strong business credibility and good privacy compliance. Strategic improvements in security headers and transparency around security policies would further enhance their posture.

15
28
2
85
72
75
100
educationcaredisabilitynon-profitspecialeducation+3 more
ASP.NET Web FormsTelerik UIjQueryGoogle Analytics (gtag.js)+4
2025-07-07T07:47:13.638Z
gocurrency.com favicon

Currency®

gocurrency.com

68
FinanceUnited StatesmediumMEDIUM

Currency® is a fintech company specializing in providing fast and secure financing solutions for heavy equipment, trucks, trailers, aircraft, and business working capital in the U.S. and Canada. Operating under the parent company Sandhills Global, Currency leverages a network of over 30 trusted lenders to facilitate loans and leases, serving over 200,000 businesses with significant funding volumes. The website presents a professional and comprehensive platform with clear navigation, rich content, and multiple financing product offerings tailored to various industries such as agriculture, construction, and transportation. Technically, the website is built on WordPress and utilizes modern web technologies including jQuery, Google Tag Manager, and Slick Slider for interactive content. The site is mobile-optimized, accessible, and SEO-friendly, with structured data enhancing search engine visibility. Security posture is strong with HTTPS enforced, appropriate security headers, and no visible vulnerabilities. Privacy compliance is addressed with clear privacy and cookie policies, including consent mechanisms and GDPR considerations. However, the WHOIS data for the domain www.gocurrency.com is missing or indicates the domain is not registered, which is inconsistent with the active and professional website presence. This discrepancy suggests the need for further verification of domain registration status. Overall, the site demonstrates a mature digital presence with robust business credibility but requires attention to domain registration transparency. Strategic recommendations include publishing a dedicated security policy, establishing vulnerability disclosure and incident response contacts, and continuous auditing of third-party scripts to maintain security integrity.

50
68
17
95
47
85
100
financeequipmentfinancingaircraftfinancingbusinessloansfintech+1 more
jQueryGoogle Tag ManagerYouTube Player APISlick Slider+2

Partner Domains:

sandhills.com
parent
2025-07-07T06:44:47.391Z
nglccny.org favicon

National LGBT Chamber of Commerce New York

nglccny.org

56
OtherUnited StatesmediumMEDIUM

The National LGBT Chamber of Commerce New York (nglccNY) serves as the New York Metro headquarters for the National LGBT Chamber of Commerce, a leading non-profit advocacy organization dedicated to expanding economic opportunities for the LGBT community. The organization focuses on certifying LGBT-owned businesses and advocating for their advancement in the marketplace. The website reflects a professional and consistent brand presence, targeting LGBT business owners and allies with services centered on certification and advocacy. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and integrates SEO tools like Yoast SEO. It uses Google Analytics and Tag Manager for tracking and marketing forms for engagement. The site is hosted on Azure CDN, indicating a reliable hosting infrastructure. Mobile optimization and SEO practices are good, though accessibility features are basic. From a security perspective, the site uses HTTPS as indicated by canonical URLs, but lacks visible security headers in the provided data. No exposed sensitive data or vulnerabilities were detected. Privacy and cookie policies are not explicitly found, which is a compliance gap. WHOIS data is privacy protected or unavailable, which is typical for non-profits but limits domain trust verification. Overall, the website presents a trustworthy and professional front for a non-profit advocacy organization with moderate technical maturity and some room for improvement in privacy compliance and security hardening. Strategic recommendations include implementing explicit privacy and cookie policies, enhancing security headers, and improving accessibility to strengthen trust and compliance.

30
35
10
70
62
65
100
lgbtbusinessnon-profitcertificationadvocacy+2 more
WordPressYoast SEOGoogle AnalyticsFontAwesome+2
2025-07-07T06:44:07.316Z