Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

148892
Websites
130
Industries
113
Countries
52
Avg Score
Page 112 of 2978|Showing 5551-5600 of 148892
companywall.co.uk favicon

CompanyWall

companywall.co.uk

10
FinanceUnited KingdomsmallCRITICAL

CompanyWall is a UK-based financial data platform specializing in providing credit rating information and comprehensive financial analysis of UK companies. Established in 2013, it offers various subscription and pay-per-report services tailored to business entities seeking reliable financial insights for business expansion and risk management. The platform is supported by a consistent brand presence and active social media channels, reinforcing its market position as a trusted financial data provider. Technically, the website employs a modern tech stack including Bootstrap, jQuery, FontAwesome, and Google reCAPTCHA, hosted by GoDaddy. The site is mobile-optimized with good SEO practices and uses HTTPS to secure user interactions. However, some security headers are missing, and cookie consent mechanisms could be improved to enhance privacy compliance. Security posture is solid with HTTPS and bot protection on forms, but lacks explicit security policies and incident response contacts. No vulnerabilities or exposed sensitive data were detected. Overall, the site demonstrates a good balance of usability, security, and business credibility, suitable for its target audience. Strategically, CompanyWall should focus on enhancing privacy compliance by implementing cookie consent banners, adding security headers, and publishing a dedicated security policy to further build trust and meet regulatory requirements.

-
-
-
-
-
-
-
businessfinancecreditratingukcompaniesfinancialanalysis
jQueryBootstrap 4.3.1FontAwesome 5jQuery UI+3

Partner Domains:

companywall.ba
partner
companywall.hr
partner

+3 more partners

2025-10-31T10:07:57.257Z
psnmedia.de favicon

psn media GmbH & Co. KG

psnmedia.de

10
TechnologyGermanymediumCRITICAL

psn media GmbH & Co. KG is a well-established digital agency based in Rostock, Germany, operating since 2003. The company offers a comprehensive portfolio of digital services including web design, web development, app development for iOS and Android, individual software solutions, corporate design, and cross-media marketing campaigns. Their client base spans from medium-sized enterprises to large corporations and public institutions, positioning them as a versatile and reliable partner in the digital transformation space. The website reflects a professional and consistent brand image with clear navigation and rich content tailored to business clients seeking digital innovation. Technically, the website employs modern web technologies such as Bootstrap, jQuery, and slick carousel for UI components, alongside analytics and tracking tools including Google Analytics, Facebook Pixel, and Mouseflow. The site uses HTTPS with good SSL configuration and integrates a consent management platform to comply with GDPR requirements. While the site lacks explicit security headers and a public security policy, it demonstrates a solid baseline security posture with no visible vulnerabilities or exposed sensitive data. From a security perspective, the site benefits from encrypted communications and user consent mechanisms for tracking. However, it could improve by implementing additional HTTP security headers and publishing incident response contacts or security policies. The WHOIS data aligns well with the website's claims, showing consistent domain registration and no suspicious patterns, supporting the legitimacy of the business. Overall, psn media presents a trustworthy and professional digital presence with strong business credibility and good privacy compliance. The site is well-optimized for user experience and mobile devices, making it suitable for its target audience of businesses seeking digital agency services.

-
-
-
-
-
-
-
webdesignwerbeagenturinternetagenturdigitalagenturrostock+6 more
jQueryBootstrapSlick CarouselAOS (Animate On Scroll)+3

Partner Domains:

go-digital.psnmedia.de
partner
www.mitkomm.app
partner
2025-10-31T10:07:42.214Z
bavariabratislava.sk favicon

BAVARIA Bratislava s.r.o.

bavariabratislava.sk

10
TransportationSlovakiamediumCRITICAL

BAVARIA Bratislava s.r.o. operates as an authorized BMW dealership and service center located in Bratislava, Slovakia. The company offers a comprehensive range of BMW vehicles including new and used cars, alongside financial services, servicing, and original accessories. Positioned as the largest and most modern BMW showroom in Slovakia, it targets BMW customers seeking premium automotive products and services. The website reflects a professional and consistent brand image aligned with BMW standards. Technically, the website is built on the siteLAB CMS platform and incorporates modern JavaScript libraries such as Swiper.js and Owl Carousel for UI components, along with Google reCAPTCHA for form security and Facebook SDK for customer chat integration. The site is mobile-optimized and includes SEO best practices, although some accessibility features could be enhanced. From a security perspective, the site enforces HTTPS and integrates anti-bot measures via reCAPTCHA. However, it lacks explicit security headers and a published security policy or incident response contact, which are recommended for enhanced trust and compliance. Privacy and cookie policies are well implemented with clear consent mechanisms, supporting GDPR compliance. Overall, the website presents a low-risk profile with strong business credibility and good technical implementation. Strategic improvements in security headers and incident response transparency would further strengthen its posture.

-
-
-
-
-
-
-
bmwcardealershipautomotiveslovakiaauthorizeddealer+3 more
JavaScriptjQuerySwiper.jsOwl Carousel+5

Partner Domains:

www.bmweshop.sk
partner
plan.soft-nrg.com
partner

+2 more partners

2025-10-31T10:06:21.899Z
glende-consulting.de favicon

Glende.Consulting GmbH & Co. KG

glende-consulting.de

55
OtherGermanysmallMEDIUM

Glende.Consulting GmbH & Co. KG is a specialized consulting firm based in Germany focusing on data protection and information security services. Their offerings include external data protection officer services, audits, NIS-2 compliance consulting, cyber risk assessments, and executive training. The company positions itself as a trusted partner for businesses needing to comply with evolving EU regulations such as GDPR and NIS-2. The website reflects a professional and consistent brand image with clear contact information and membership in relevant industry associations, indicating a credible market presence. Technically, the website is built on Joomla! CMS with UIkit and Yootheme frameworks, ensuring a modern and responsive user experience. Accessibility features are implemented, and the site uses HTTPS with a good SSL configuration. However, some security headers are missing, and no cookie consent mechanism is present, which could be improved for better compliance and security posture. Security-wise, the site demonstrates good practices such as CSRF tokens and no exposed sensitive data. The absence of explicit incident response or vulnerability disclosure policies suggests room for enhancement in transparency and readiness. Overall, the domain registration data aligns well with the business claims, supporting legitimacy. The risk assessment indicates a low threat level with no suspicious content or vulnerabilities detected. Strategic recommendations include implementing cookie consent, adding security headers, and publishing clear security and incident response policies to strengthen trust and compliance.

60
33
15
85
72
70
20
datenschutzinformationssicherheitnis-2cyberrisikocheckaudits+1 more
Joomla!UIkitYoothemeAwesomplete+1
2025-10-31T10:06:11.840Z
N

Noembed - oEmbed everything.

noembed.com

50
TechnologyN/asmallMEDIUM

Noembed.com is a specialized technology service providing a unified oEmbed proxy API that simplifies embedding content from a wide range of supported sites, including those without native oEmbed support. The service targets developers and web integrators who require consistent embeddable content responses. The business operates as a small entity with open source code hosted on GitHub and is supported by a community of users and contributors. The website is professionally designed with clear navigation and good content relevance, though it lacks formal privacy and cookie policies. Technically, the site uses standard web technologies including HTML5, CSS3, and JavaScript, and is hosted on the Fastly CDN platform, ensuring good performance and reliability. Google Analytics is used for visitor tracking, but no advanced frameworks or CMS are detected. Mobile optimization and accessibility are basic but adequate for the target audience. From a security perspective, the domain registration is consistent and legitimate, registered with Gandi SAS since 2011, with clientTransferProhibited status enabled. However, DNSSEC is not enabled, and the website lacks security headers and formal security policies. No forms or sensitive data collection mechanisms are present, reducing attack surface. Privacy compliance is weak due to missing policies and cookie consent mechanisms. Overall, the website presents a moderate risk profile with no critical vulnerabilities detected but would benefit from improved privacy compliance and security hardening. Strategic recommendations include enabling DNSSEC, adding privacy and cookie policies, implementing security headers, and publishing incident response and vulnerability disclosure information.

15
35
2
40
62
70
100
oembedapiembeddingdeveloperopensource+2 more
HTML5CSS3JavaScriptGoogle Analytics
2025-10-31T10:05:36.734Z
tecc-germany.de favicon

DBRD Akademie GmbH

tecc-germany.de

54
EducationGermanysmallMEDIUM

TECC Germany, operated by DBRD Akademie GmbH, is a specialized educational provider offering Tactical Emergency Casualty Care courses tailored for police, fire services, personal protection, and rescue personnel in Germany. The website presents detailed course offerings, schedules, and pricing, establishing a clear market position as a niche training provider in tactical emergency medical care. The business model focuses on in-person and scenario-based training with transparent pricing and no sponsorship conflicts. Technically, the website is built on Joomla CMS with Yootheme templates and UIkit framework, incorporating modern web technologies such as Typed.js and Google Fonts. The site is mobile-optimized and includes accessibility features, providing a good user experience. However, some improvements in security headers and cookie consent mechanisms could enhance compliance and security posture. Security-wise, the site enforces HTTPS and uses CSRF tokens, with no visible sensitive data exposure. The absence of explicit security policies and incident response contacts is noted. The domain registration data is consistent with the business claims, showing legitimacy and stability. Overall, the site demonstrates a solid security posture with room for improvement in privacy compliance. The overall risk assessment is low, with recommendations focusing on enhancing privacy compliance, adding security headers, and publishing security policies to strengthen trust and regulatory adherence.

20
28
2
70
67
60
100
educationtrainingmedicalemergencytactical+3 more
Joomla CMSYootheme TemplateUIkit FrameworkTyped.js+3

Partner Domains:

dbrd-akademie.de
partner
dbrd.de
partner

+3 more partners

2025-10-31T10:05:11.650Z
emfrt.de favicon

DBRD Akademie GmbH

emfrt.de

56
EducationGermanysmallMEDIUM

The website emfrt.de represents the Emergency Medical Fire and Rescue Training (EMFRT) program operated by DBRD Akademie GmbH, a German educational organization specializing in emergency medical and rescue training. The site targets fire departments, authorities, and organizations with security tasks, offering practical and intensive courses that combine preclinical emergency medicine, technical rescue, and firefighting. The business is positioned as a specialized training provider with recognized certifications and strong partnerships, including Weber Rescue and Siegerland Airport. The courses are certified and include international certificates such as PHTLS for First Responders. Technically, the website is built on Joomla CMS with Yootheme templates and uses modern frontend technologies like jQuery, Leaflet.js, and UIkit. The site is mobile optimized, accessible, and performs moderately well. Structured data in JSON-LD format is implemented for SEO and organizational clarity. The hosting provider is not explicitly identified, but HTTPS is enforced with good SSL configuration. From a security perspective, the site uses HTTPS and includes CSRF tokens and email obfuscation techniques. However, it lacks explicit security headers and published security or incident response policies. There is no vulnerability disclosure or security.txt file. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected, which could be a GDPR compliance gap. Overall, the website is professional, trustworthy, and well-aligned with its business goals. The domain WHOIS data is consistent and legitimate, supporting the business's credibility. Strategic improvements in privacy compliance and security transparency would enhance the site's security posture and regulatory adherence.

40
28
2
70
62
60
100
emergencymedicalfirerescuetraining+4 more
Joomla CMSYootheme TemplatejQueryLeaflet.js+3

Partner Domains:

dbrd-akademie.de
partner
shop.dbrd.de
partner

+1 more partners

2025-10-31T10:04:46.503Z
A

Ably

ably-realtime.com

74
TechnologyN/amediumMEDIUM

Ably is a mature and established realtime platform company founded in 2002, specializing in scalable, reliable, and low-latency realtime data streaming and messaging services. Their platform supports a broad range of realtime applications including live messaging, chat, dashboards, notifications, and collaborative apps. The company positions itself as a leader in the realtime pub/sub market, serving over 2 billion connected devices monthly with a strong uptime record. Their business model is SaaS-based with usage-based pricing tiers including Free, Standard, Pro, and Enterprise plans, targeting developers and businesses requiring realtime infrastructure. Technically, the website is built on modern frameworks such as Gatsby and React, hosted with Cloudflare DNS and Amazon Registrar, and integrates marketing and analytics tools like HubSpot, Intercom, and Google Tag Manager. The site is fast, mobile-optimized, and accessible with good SEO practices. Security posture is strong with HTTPS, security headers, and enterprise-grade compliance such as SOC 2 and HIPAA BAA, although DNSSEC is not enabled and explicit security policies or incident response contacts are not published. Privacy compliance is partially addressed with a cookie consent mechanism but lacks a clearly linked privacy policy or terms of service on the homepage. Overall, Ably demonstrates a high level of professionalism, technical maturity, and business credibility with minor gaps in explicit privacy and security disclosures.

60
88
47
75
57
80
100
realtimemessagingpubsubchatcollaboration+3 more
ReactGatsbyCloudflare DNSGoogle Tag Manager+3
2025-10-31T10:04:36.485Z
serapis-medical.de favicon

SERAPIS Medical GmbH

serapis-medical.de

61
HealthcareGermanysmallMEDIUM

SERAPIS Medical GmbH is a specialized healthcare transportation service provider based in Ludwigsburg, Germany. The company focuses on qualified patient transport, emergency medical support, and international patient repatriation. Their website reflects a professional and consistent brand image, targeting patients and healthcare providers who require reliable medical transport services. The business operates a small-scale model with a clear regional focus and offers key services such as ambulance service, regular patient transport, and medical repatriation with professional care. Technically, the website is built on a modern WordPress platform using Elementor and JupiterX theme, supported by plugins like Complianz for GDPR compliance. The site is mobile-optimized and performs moderately well, with good SEO and basic accessibility features. The technical infrastructure is sound, though some improvements in security headers and incident response documentation could enhance the security posture. Security-wise, the site enforces HTTPS and uses a cookie consent mechanism compliant with GDPR. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of explicit security policies, incident response contacts, and vulnerability disclosure mechanisms suggests room for improvement in security maturity. Overall, the website is trustworthy, professionally maintained, and compliant with privacy regulations. The risk level is low, but strategic enhancements in security policies and transparency would strengthen the company’s security and compliance posture further.

20
80
2
70
77
60
100
healthcarepatienttransportemergencymedicalservicesgdprwordpress+1 more
WordPress 6.8.3Elementor 3.28.3JupiterX themejQuery 3.7.1+2
2025-10-31T10:04:16.446Z
mum-lifeline.de favicon

M&M Lifeline

mum-lifeline.de

64
HealthcareGermanysmallMEDIUM

M&M Lifeline is a specialized provider of certified seminars and training programs primarily targeting healthcare professionals and nursing staff in Germany. Established in 2003, the company offers a variety of in-house, online, and presence seminars focusing on emergency response, first aid, and nursing-related topics. Their market position is supported by over 20 years of experience and certification by recognized bodies such as the MDK. The website reflects a professional and consistent brand image with clear navigation and relevant content tailored to their audience. Technically, the website is built on WordPress using modern plugins and frameworks such as Avia Framework and WPForms. It employs HTTPS with excellent SSL configuration and includes GDPR-compliant cookie consent mechanisms. Performance is moderate with good mobile optimization and basic accessibility features. Analytics are implemented via Jetpack Statistics, with moderate user tracking and good privacy compliance. From a security perspective, the site enforces HTTPS and uses cookie consent but lacks explicit security headers and a dedicated security policy or incident response information. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is consistent with the business claims, showing a domain age appropriate for the company's history and no privacy protection, enhancing trustworthiness. Overall, the website presents a low-risk profile with strong business credibility and compliance posture. Strategic improvements could focus on enhancing security headers, publishing a security policy, and improving accessibility to further strengthen the security and user experience.

20
95
17
70
67
60
100
healthcaretrainingseminarsfirstaidemergency+4 more
WordPressPHPjQueryAvia Framework+3

Partner Domains:

mum-lifeline.jobs.personio.de
partner
2025-10-31T10:04:06.423Z
intensivmedizin.at favicon

Österreichische Gesellschaft für Internistische und Allgemeine Intensivmedizin und Notfallmedizin (ÖGIAIN)

intensivmedizin.at

44
HealthcareAustriasmallHIGH

The website intensivmedizin.at represents the Österreichische Gesellschaft für Internistische und Allgemeine Intensivmedizin und Notfallmedizin (ÖGIAIN), a professional Austrian medical society focused on intensive and emergency medicine. The site serves as an information hub for medical professionals, offering details on scientific funding, educational events, webinars, and member services. The content is well-structured, professionally presented, and targets healthcare practitioners and researchers in Austria. The society collaborates with other medical organizations and hosts multiple events annually, reinforcing its position in the Austrian healthcare community. Technically, the website is built on Drupal 7 with jQuery and uses responsive design techniques to ensure usability across devices. While the site performs moderately well and offers good mobile optimization, it lacks modern security headers and explicit privacy and cookie policies, which are important for compliance and user trust. No advanced analytics or tracking scripts were detected, indicating a minimal user tracking approach. From a security perspective, the site uses HTTPS (implied by canonical URLs), but no explicit security headers were found in the provided data. There is no visible incident response or vulnerability disclosure information, which could be improved to enhance security posture. The WHOIS data aligns well with the website's claims, showing consistent registration details and legitimacy. Overall, the site is a credible and professional platform for a specialized medical society but would benefit from enhanced privacy compliance, security best practices, and transparency measures to improve trust and regulatory adherence.

40
10
17
62
67
85
-
healthcaremedicalsocietyintensivecareemergencymedicineaustria+2 more
Drupal 7jQuerySuperfish menuResponsive CSS
2025-10-31T10:03:51.393Z
sonderborg.dk favicon

Sønderborg Kommune

sonderborg.dk

67
GovernmentDenmarkmediumMEDIUM

Sønderborg Kommune operates an official municipal website providing comprehensive information on culture, jobs, newcomer services, youth programs, and business opportunities within the Sonderborg region of Denmark. The website serves as a key digital portal for residents and visitors, positioning itself as a trusted source of local government information and community engagement. The business model is focused on public service and community support, with a medium-sized organizational footprint consistent with municipal operations. Technically, the website is built on WordPress using the Divi theme, integrating modern web technologies such as jQuery, Matomo analytics for privacy-conscious tracking, and Cookiebot for cookie consent management. The site demonstrates good SEO practices and mobile optimization, though accessibility features are basic. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and uses cookie consent mechanisms, but lacks advanced security headers and published security policies or incident response information. No vulnerabilities or exposed sensitive data were detected in the analyzed content. The domain registration is consistent and longstanding, reinforcing trustworthiness. Overall, the website presents a professional and credible digital presence for the municipality, with recommendations to enhance security posture by enabling DNSSEC, adding security headers, and publishing security and vulnerability disclosure policies to further strengthen trust and compliance.

45
83
2
87
67
70
100
governmentmunicipalityculturejobsnewcomer+2 more
WordPressDivi ThemejQueryMatomo Analytics+2
2025-10-31T10:03:41.370Z
hr-skyen.dk favicon

HR-ON

hr-skyen.dk

62
TechnologyDenmarkmediumMEDIUM

HR-ON is a Denmark-based technology company specializing in providing a modern recruitment and HR system tailored for contemporary HR teams. Founded in 2015, the company offers a SaaS platform that integrates recruitment, staffing, onboarding, core HR functions, and employee wellbeing services. The website reflects a professional and consistent brand image, targeting HR professionals and organizations seeking efficient HR management solutions. The company maintains an active digital presence with multiple social media channels and employs various marketing and analytics tools to optimize user engagement and business growth. Technically, the website is built on WordPress and leverages a comprehensive tech stack including Yoast SEO, Google Tag Manager, Google Analytics, Facebook Pixel, Hotjar, and other marketing automation tools. Hosting is provided via one.com, with domain registration dating back to 2015, consistent with the company's founding year. The site demonstrates good SEO practices, mobile optimization, and moderate performance, although accessibility features are basic. From a security perspective, the site uses HTTPS and incorporates reCAPTCHA for form protection. However, DNSSEC is not enabled, and explicit security headers are not detected in the provided data. There is no visible privacy policy or terms of service in the analyzed content, which represents a compliance gap. No vulnerability disclosures or incident response contacts are published. The WHOIS data shows a stable and legitimate domain registration without privacy protection, enhancing trustworthiness. Overall, HR-ON presents a credible and professional online presence with a solid technical foundation and active marketing efforts. To enhance security and compliance posture, the company should consider publishing comprehensive privacy and terms policies, enabling DNSSEC, and adding security headers. These improvements will strengthen user trust and regulatory compliance.

20
95
17
100
62
80
40
hrrecruitmentsaastechnologystaffing+1 more
WordPressYoast SEOGoogle Tag ManagerGoogle Analytics+10
2025-10-31T10:03:26.297Z