Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 100 of 3147|Showing 4951-5000 of 157326
silvershieldwindscreens.co.uk favicon

Silver Shield Windscreens

silvershieldwindscreens.co.uk

50
TransportationUnited KingdomsmallMEDIUM

Silver Shield Windscreens is a UK-based company specializing in automotive glass repair and replacement services, including windscreen repairs, replacements, fleet services, specialist glazing, and ADAS recalibration. The company targets fleet owners, business owners, and private vehicle owners across England and Wales, emphasizing quality service at competitive prices with trained technicians and insurance claim support. The website presents a professional image with clear contact details and service descriptions. Technically, the website employs legacy technologies such as jQuery 1.8.3 and Modernizr 2.6.2, alongside Google Analytics and Tag Manager for tracking. The site is mobile-optimized with a cookie consent mechanism, but lacks visible modern security headers and uses an outdated JavaScript library, which may pose security risks. Performance is moderate, and SEO practices are adequately implemented. From a security perspective, the site uses HTTPS (assumed from external scripts loaded via HTTPS), but no explicit security headers were detected in the provided data. The cookie consent banner and privacy policies indicate GDPR compliance efforts, though no incident response or vulnerability disclosure information is present. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy, though the website content is consistent with a legitimate business. Overall, the website is functional and professional but would benefit from technical and security improvements, including updating libraries, implementing security headers, and clarifying domain registration status to enhance trust and compliance.

47
60
85
20
15
95
2
windscreenrepairwindscreenreplacementfleetservicesadasrecalibrationspecialistglazing+3 more
jQuery 1.8.3Google AnalyticsGoogle Tag ManagerModernizr 2.6.2+1
2026-07-10T07:09:34.977Z
bishoptonvets.co.uk favicon

Bishopton Veterinary Group

bishoptonvets.co.uk

65
HealthcareUnited KingdommediumMEDIUM

Bishopton Veterinary Group is an established independent veterinary practice based in Yorkshire, UK, with over 80 years of experience. The company provides a broad range of veterinary services including small animal care, farm animal services, pig herd health consulting, and equine veterinary care. They operate multiple branches across Yorkshire and offer 24-hour emergency cover, positioning themselves as a trusted regional veterinary provider. Their business model focuses on comprehensive animal healthcare with additional offerings such as a Lifetime Care Club to support preventative care budgeting for pet owners. Technically, the website is built on an ASP.NET WebForms platform with a mix of legacy and modern web technologies including jQuery, Google reCAPTCHA v3, and Slick Carousel. The site is mobile optimized with good SEO practices and a professional design. While the CMS appears proprietary or custom, the infrastructure supports a moderate performance level and basic accessibility features. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect its contact form from spam. However, it lacks some modern security headers and does not publish explicit security or incident response policies. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with a clear privacy policy and cookie consent mechanism. The WHOIS lookup failed due to querying a subdomain rather than the registered domain, but the website content and company registration details strongly indicate legitimacy. Overall, Bishopton Veterinary Group's website demonstrates a solid business presence with good technical and security practices. Strategic improvements in security headers, incident response transparency, and updating legacy libraries would further enhance their security posture and trustworthiness.

65
100
70
74
60
68
2
veterinarypetsfarmequinehealthcare+2 more
ASP.NET WebFormsjQuery 1.9.1AjaxControlToolkitSlick Carousel+4
2026-07-10T07:09:13.254Z
geobear.co.uk favicon

Geobear UK

geobear.co.uk

66
Real EstateUnited KingdommediumMEDIUM

Geobear UK is a specialized ground engineering company focused on providing fast, non-disruptive solutions for residential and commercial foundation problems caused by subsidence. The company positions itself as a niche expert in subsidence repair across the UK, targeting homeowners and commercial property owners. Their key services include subsidence repair, residential foundation stabilization, and infrastructure ground engineering. The website reflects a professional and consistent brand image with clear navigation and contact options, supporting their market position. Technically, the website is built on the HubSpot CMS platform, utilizing modern technologies such as Bootstrap for responsive design, Google Tag Manager for analytics management, and Cookiebot for privacy compliance. The site is mobile-optimized and demonstrates good SEO and accessibility practices. Hosting appears to be supported by Cloudflare, enhancing performance and security. From a security perspective, the website enforces HTTPS and employs cookie consent mechanisms that comply with GDPR. Security headers are partially detected or implied, and no critical vulnerabilities or exposed sensitive data were found in the content. The WHOIS data is privacy-protected, which is common for businesses of this type, and does not raise immediate trust concerns given the professional website presence. Overall, the website presents a low-risk profile with strong business credibility and good privacy compliance. Strategic recommendations include enhancing explicit security headers, continuous monitoring of third-party scripts, and ensuring robust form security to maintain and improve the security posture.

75
100
49
70
95
2
50
subsidencefoundationrepairgroundengineeringukconstruction+4 more
HubSpot CMSGoogle Tag ManagerCookiebotBootstrap+2

Partner Domains:

villaagare.geobear.com
subsidiary
underpinning.geobear.com
subsidiary

+3 more partners

2026-07-10T07:08:52.027Z
directvehicleglass.co.uk favicon

Direct Vehicle Glass

directvehicleglass.co.uk

46
TransportationUnited KingdommediumHIGH

Direct Vehicle Glass is a well-established UK-based company specializing in mobile windscreen repair and replacement services, primarily serving Liverpool, Warrington, Manchester, and the wider North West region. The company positions itself as a leading independent automotive glazing provider with a focus on quality and responsiveness. Their key services include private and commercial vehicle glass repair, fleet cover, and advanced driver assistance system (ADAS) calibration. The website reflects a medium-sized business with a professional online presence and multiple insurance partnerships that enhance trustworthiness. Technically, the website is built on WordPress and utilizes modern web technologies such as jQuery, Slick Carousel, and Google Analytics for tracking. The site is mobile-optimized with good SEO practices implemented via Yoast SEO. Performance is moderate, and accessibility is basic but functional. The site uses HTTPS with an excellent SSL configuration, though it lacks some security headers that could improve its security posture. From a security perspective, the site demonstrates good baseline practices such as HTTPS and no visible sensitive data exposure. However, it lacks published security policies, incident response information, and a cookie consent mechanism, which are important for GDPR compliance and user trust. No vulnerabilities or suspicious content were detected. The domain registration data aligns well with the business claims, indicating legitimacy and a strong trust foundation. Overall, the website is professional, credible, and secure enough for its business purpose but would benefit from enhanced privacy compliance and security transparency to improve user trust and regulatory adherence.

70
65
20
47
53
17
15
windscreenrepairvehicleglassmobileserviceadascalibrationfleetcover+4 more
jQuerySlick CarouselGoogle AnalyticsYoast SEO
2026-07-10T07:07:53.481Z
traffixuk.com favicon

Traffix Ltd

traffixuk.com

61
TransportationUnited KingdommediumMEDIUM

Traffix Ltd is a well-established UK-based company specializing in temporary traffic and event management services. Operating since 2005 with a domain registered in 2006, the company maintains a strong market position in the transportation sector, serving complex infrastructure projects, construction, highway maintenance, utilities, and high-profile events. Their service portfolio is comprehensive, supported by multiple strategically located depots and a 24/7 emergency callout service. The website reflects a professional and consistent brand image with clear navigation and relevant content targeting businesses and organizations requiring traffic management solutions in Central England and beyond. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, WPBakery Page Builder, and Slider Revolution. It employs Google Analytics and Facebook Pixel for analytics and marketing, and implements cookie consent mechanisms aligned with GDPR requirements. Hosting is provided by s2hosting.co.uk, and the site shows good mobile optimization and moderate performance. Security posture is solid with HTTPS enabled and reCAPTCHA on forms, though improvements could be made by enabling DNSSEC and adding security headers. No WAF or blocking mechanisms were detected, allowing full content access. The WHOIS data is consistent with the business claims, showing a long domain age and transparent registration without privacy protection, supporting legitimacy. Contact information is clearly presented with multiple phone numbers, emails, and physical addresses. Social media presence is active across major platforms, enhancing trust and outreach. Overall, Traffix Ltd demonstrates a mature digital presence with good security and privacy compliance, making it a trustworthy and professional service provider in its industry.

60
100
85
27
45
85
2
trafficmanagementeventmanagementtransportationukbusinesswordpress+3 more
WordPressPHPYoast SEO pluginWPBakery Page Builder+7
2026-07-10T07:07:42.790Z
satbill.co.uk favicon

Symbiosys Business Solutions Ltd

satbill.co.uk

66
TelecommunicationsUnited KingdommediumMEDIUM

Symbiosys Business Solutions Ltd operates the SATbill platform, a specialized satellite airtime billing solution designed for satellite service providers and operators worldwide. The company offers a comprehensive software product that supports billing for multiple providers, call types, and value-added services, with strong customization and integration capabilities. Their market position is supported by a global client base, multi-entity billing features, and significant invoicing volume, positioning them as a key player in the satellite telecommunications billing niche. Technically, the website is built on the HubSpot CMS platform, leveraging modern web technologies including Google Fonts, jQuery, and various analytics and marketing tools such as Google Analytics, Hotjar, and LinkedIn Insight. The site is well-optimized for mobile and accessibility, with good SEO practices and a professional design that enhances user experience. From a security perspective, the site enforces HTTPS, uses reCAPTCHA on forms, and benefits from HubSpot's security headers and infrastructure. However, the absence of explicit security policy pages and vulnerability disclosure mechanisms suggests room for improvement in transparency and incident response readiness. The WHOIS data is missing or indicates the domain may not be registered, which raises concerns about domain legitimacy despite the professional website content. Overall, the website presents a trustworthy and professional front for a specialized business solution, but the lack of WHOIS registration data and explicit security policies slightly reduce the overall trust score. Strategic recommendations include establishing clear security and incident response documentation, verifying domain registration, and enhancing transparency to strengthen stakeholder confidence.

44
70
60
100
75
17
83
satellitebillingtelecommunicationssoftwaresatcom+2 more
HubSpot CMSGoogle FontsjQuerySlick Carousel+7
2026-07-10T07:07:26.842Z
directeng.co.uk favicon

403 - Forbidden

directeng.co.uk

41
OtherN/asmallHIGH

The website www.directeng.co.uk is currently inaccessible, returning a 403 Forbidden error page that blocks access to any meaningful content. The domain WHOIS lookup failed with an error indicating the domain name is invalid under Nominet UK naming rules, suggesting the domain may not be properly registered or is misconfigured. Due to the lack of accessible content, no business information, contact details, or policies are available for analysis. The technical infrastructure appears minimal with only Google Fonts loaded externally, and no security headers or HTTPS information is present in the provided data. This results in a very low confidence in the website's operational status and legitimacy. From a security perspective, the absence of HTTPS, security headers, and privacy compliance measures indicates a poor security posture. The lack of contact or incident response information further limits trust and compliance assessment. Overall, the site appears either offline, blocked, or misconfigured, and the domain registration issues raise legitimacy concerns. Strategically, the business should address domain registration compliance, ensure the website is accessible with proper HTTP status codes, implement HTTPS with valid SSL certificates, and publish essential policies and contact information to improve trust and compliance. Until these issues are resolved, the website cannot be reliably assessed or trusted.

70
-
57
80
35
2
70
403forbiddenerrorblockednoindex
2026-07-10T07:07:05.556Z
B

Banana Dance Ltd

bananadance.com

56
RetailUnited KingdomsmallMEDIUM

Banana Dance Ltd is a specialized antiques dealer based in London, focusing on Clarice Cliff and Art Deco ceramics, glass, and general antiques. The company operates both a physical presence in the Northcote Road Antiques Market and an online platform showcasing a wide range of collectible items. Their market position is that of a long-established and leading specialist in their niche, targeting collectors and enthusiasts of vintage ceramics and antiques. Technically, the website employs a traditional tech stack with older versions of jQuery and jQuery UI, alongside Google Maps API and various jQuery plugins for UI enhancements. While the site is functional and moderately optimized for performance and SEO, mobile optimization and accessibility are basic and could be improved. The site uses HTTPS and Google Tag Manager for analytics but lacks modern security headers and updated libraries, which could pose security risks. From a security perspective, the site shows moderate maturity with HTTPS enabled and no exposed sensitive data. However, the absence of security headers, outdated JavaScript libraries, and missing privacy and cookie policies indicate compliance and security gaps. The lack of WHOIS data reduces domain trustworthiness, although the website content and contact information appear professional and legitimate. Overall, Banana Dance Ltd presents a credible and professional online presence for their antiques business but should address privacy compliance, update technical components, and enhance security measures to improve trust and reduce risk.

100
67
75
60
17
35
25
antiquesclaricecliffartdecoceramicscollectables+3 more
jQuery 1.7.1jQuery UI 1.8.11Google Maps API v3Modernizr 2.5.3+4
2026-07-10T07:06:28.250Z
D

Security Verification

dmburgess.co.uk

46
OtherN/asmallHIGH

The website www.dmburgess.co.uk currently serves a security verification page that employs Google reCAPTCHA v3 to prevent automated access. This indicates the presence of a Web Application Firewall (WAF) or bot protection mechanism restricting normal user access. Due to this, no meaningful business content, contact information, or company details are accessible for analysis. The domain WHOIS lookup failed due to domain naming rules violations, providing no registrar or registrant data, which raises concerns about domain legitimacy and registration status. Technically, the site uses Bootstrap 5.3.3 for styling and Google reCAPTCHA for bot mitigation. However, there is no evidence of HTTPS enforcement or security headers in the provided data. The absence of privacy, cookie, or terms of service policies further indicates a lack of compliance with common data protection regulations such as GDPR. The site’s content quality and user experience are poor due to the blocking mechanism and minimal content. From a security perspective, the site shows basic bot protection but lacks comprehensive security best practices such as HTTPS, security headers, and clear privacy policies. The inability to access the actual website content and the lack of WHOIS data significantly limit trust and credibility assessments. Overall, the site’s risk profile is elevated due to these factors, and it is recommended to verify domain registration and improve transparency and security posture. Strategic recommendations include implementing HTTPS, publishing privacy and cookie policies, providing verifiable business contact information, enhancing security headers, and reviewing domain registration status to ensure legitimacy and compliance.

57
100
60
60
2
15
50
securitycaptchabotprotectionverification
Bootstrap 5.3.3Google reCAPTCHA v3
2026-07-09T07:27:21.226Z
elfrida.com favicon

The Elfrida Society

elfrida.com

48
Non-profitUnited KingdomsmallHIGH

The Elfrida Society is a well-established non-profit organization dedicated to supporting individuals with learning disabilities, autism, and learning difficulties. With over 100 years of history, it provides advocacy, community engagement, inclusive sports, and various support services primarily in Islington and London. The website reflects a professional and community-focused charity with clear mission, vision, and values. The organization maintains active social media channels and offers multiple ways for the public to engage, donate, or volunteer. Technically, the website employs a modern tech stack including Bootstrap, jQuery, and various UI and animation libraries. It is mobile-optimized with good SEO and accessibility basics, though some accessibility features could be enhanced. The site uses HTTPS with a strong SSL configuration and implements cookie consent mechanisms, reflecting good privacy compliance. However, security headers are missing, and no explicit security policy or incident response contact is provided. From a security perspective, the site shows a mature posture with no visible vulnerabilities or exposed sensitive data. The absence of WHOIS registration data is a concern, as it reduces transparency and trust, though the website content and business information appear legitimate and consistent with a reputable charity. No signs of WAF blocking or security challenges were detected, allowing full content access. Overall, the site scores well on content quality, technical implementation, and security posture, with minor penalties for missing WHOIS data and security headers. Strategic improvements in security headers, incident response transparency, and WHOIS data clarity would enhance trust and compliance.

-
75
85
57
15
17
53
non-profitlearningdisabilitiesautismsupportcommunityadvocacy+2 more
BootstrapjQueryAOS (Animate On Scroll)Font Awesome+8
2026-07-09T07:27:05.064Z