Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 10 of 16|Showing 451-500 of 792
retronic.de favicon

Retronic Vertriebs GmbH

retronic.de

35
TechnologyGermanymediumHIGH

Retronic Vertriebs GmbH is an established German distributor specializing in electronic components, serving various industries including technology and transportation. With over 25 years of experience and TÜV ISO 9001:2015 certification, the company emphasizes long-term partnerships with manufacturers and offers tailored solutions for its clients. The website reflects a professional business model focused on reliability and technical orientation. Technically, the website is built on a modern WordPress platform using PHP 8.4.8 and Elementor for design. It incorporates SEO best practices via Yoast SEO and employs performance optimization tools like WP Rocket. However, the site lacks a valid SSL certificate and does not support HTTPS, which is a significant security shortfall. Mobile optimization and accessibility are adequate, and cookie consent mechanisms comply with GDPR requirements. From a security perspective, the absence of HTTPS and TLS protocols severely undermines the site's security posture, exposing users to potential data interception risks. While cookie consent and privacy policies are well implemented, the site should urgently address SSL/TLS configuration to protect user data and improve trustworthiness. No incident response or vulnerability disclosure policies are evident. Overall, the site is functional and professional but requires critical security improvements. Strategic recommendations include immediate SSL certificate deployment, enabling modern TLS protocols, and enhancing security headers. These steps will elevate the site's security, compliance, and user trust, aligning with its reputable business standing.

15
-
-
50
-
85
100
distributorelectroniccomponentstechnologyiso9001gdpr+3 more
PHP 8.4.8ApacheWordPress 6.8.1Elementor 3.28.4+8
2025-06-15T21:51:33.250Z
R

RUBICON IT GmbH

rubicon.eu

40
TechnologyAustriamediumHIGH

RUBICON IT GmbH is a medium-sized Austrian technology company specializing in digitalization solutions and IT services. Their product portfolio includes leading software such as Nova Find, a prominent lost and found software in Europe, alongside other enterprise solutions like Acta Nova and Document Partner. The company also offers professional services, managed services, and training, targeting business and public sector clients seeking digital transformation. The website is professionally designed, multilingual, and well-structured, reflecting a mature digital presence. Technically, the site is built on WordPress with various plugins and frameworks, including ASP.NET components, but suffers from critical SSL/TLS misconfigurations, lacking a valid certificate and modern protocol support. Security headers are partially implemented but incomplete, and no advanced security mechanisms like OCSP stapling or session resumption are enabled. Privacy compliance is strong, with clear cookie consent and a comprehensive privacy policy. Social media integration and certifications like Kubernetes demonstrate trust and industry alignment. Overall, the site is functional and business-credible but requires urgent security improvements to protect user data and enhance trust.

45
33
5
50
-
85
100
digitalizationsoftwareitservicesmanagedservicesprofessionalservices+4 more
WordPressPHPASP.NET (X-Powered-By header)jQuery+8

Partner Domains:

nova-find.eu
partnerpending
signpath.io
partnerpending
2025-06-15T21:51:17.233Z
sigal.com.al favicon

SIGAL UNIQA

sigal.com.al

40
FinanceAlbanialargeHIGH

SIGAL UNIQA is a leading regional insurance group operating primarily in Albania, Kosovo, and North Macedonia, offering a comprehensive portfolio of insurance products including life, health, property, automobile, and marine insurance. The company is well-established since 1999 and is part of the larger UNIQA Insurance Group, which enhances its market credibility and operational scale. The website reflects a professional and well-branded digital presence with clear navigation and extensive content tailored to its target audience of individuals and businesses seeking insurance solutions. Technically, the site is built on WordPress with modern plugins and integrations, but suffers from critical security shortcomings due to the absence of a valid SSL certificate and lack of HTTPS support, which poses risks to user data confidentiality and trust. The company demonstrates commitment to security governance through ISO 27001:2022 certification and implements privacy and cookie policies compliant with GDPR standards. Marketing and analytics tools such as Google Analytics, Facebook Pixel, and Mailchimp are actively used, indicating a mature digital marketing strategy. Overall, while the business and content aspects are strong, urgent improvements in SSL/TLS configuration are necessary to enhance security posture and user trust.

45
-
5
50
-
90
100
insurancefinancehealthpropertyautomobile+4 more
WordPressPHPJavaScriptjQuery+6
2025-06-15T21:51:16.916Z
jawa.at favicon

JAWA Management Software GmbH

jawa.at

23
TechnologyAustriamediumCRITICAL

JAWA Management Software GmbH is an established Austrian technology company specializing in customized software solutions for process optimization and information management. Their flagship product, the inforum management platform, supports supplier management, quality control, production planning, and AI-enhanced business solutions. With over 25 years of market presence and a medium-sized operation, JAWA serves a broad international clientele with a focus on efficiency and productivity improvements. Technically, the website is built on a modern WordPress CMS infrastructure using popular plugins and frameworks such as WPBakery, WPML, and Woodmart theme. The site is well-structured, mobile-optimized, and SEO-friendly, demonstrating a mature digital presence. However, the hosting environment lacks a valid SSL certificate and proper TLS configuration, which significantly undermines the security posture. Security-wise, the absence of HTTPS and modern TLS protocols is a critical vulnerability, exposing users to potential data interception and trust issues. While no active vulnerabilities or malware are detected, the site misses essential security headers and DNS security configurations. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms. Overall, the website presents a professional and credible business front but requires urgent security improvements to protect user data and enhance trust. Strategic recommendations include immediate SSL deployment, enabling modern security protocols, and implementing advanced security headers and DNS protections.

15
-
5
50
-
85
20
softwaremanagementprocessoptimizationtechnologybusinesssolutions+3 more
ApacheWordPress 6.8.1PHPjQuery+9
2025-06-15T21:51:16.418Z
motion06.at favicon

motion06 gmbh

motion06.at

23
TransportationAustriamediumCRITICAL

motion06 GmbH is a medium-sized Austrian company specializing in the manufacture and supply of advanced conveyor systems primarily for airport baggage handling, ecommerce logistics, and industrial intralogistics. As a global leader in its niche, motion06 offers customized hardware and software solutions to optimize logistics processes. The company operates under the parent company Duravant, reflecting a strong corporate backing and market presence. The website content is well-structured, professionally designed, and targets logistics and industrial sectors with clear product and service offerings. Technically, the website is built on WordPress with a modern tech stack including jQuery, Bootstrap, and marketing integrations such as Google Analytics and Marketo. However, the site lacks HTTPS encryption, which is a critical security flaw. Performance metrics are missing but inferred to be slow. Mobile optimization and SEO are adequately addressed, though accessibility is basic. From a security perspective, the absence of SSL/TLS and security headers significantly lowers the security posture. While cookie consent and privacy policies are implemented and GDPR compliant, there is no visible security or incident response policy. The domain registration data is consistent with the business claims, enhancing trustworthiness. Overall, the website presents a professional business front but requires urgent security improvements, especially implementing HTTPS and enhancing security headers, to protect user data and improve trust. Strategic recommendations include upgrading security infrastructure, publishing security policies, and improving performance metrics for better user experience.

15
-
-
50
-
85
20
conveyorsystemsairportbaggagehandlingintralogisticsindustrialsolutionsecommercelogistics+2 more
Apache 2.4.62Debian LinuxWordPress 6.6.2WPBakery Page Builder+9

Partner Domains:

duravant.com
parentpending
2025-06-15T21:51:03.283Z
dywidag.at favicon

DYWIDAG Dyckerhoff & Widmann GmbH

dywidag.at

23
Real EstateAustrialargeCRITICAL

DYWIDAG Dyckerhoff & Widmann GmbH is a well-established construction company operating primarily in Austria and Southern Bavaria, specializing in general contracting and complex construction projects. The company holds multiple recognized certifications such as ISO 9001, ISO 45001, and compliance management certifications, underscoring its commitment to quality and safety. Their website reflects a professional business with a clear focus on construction services, career opportunities, and regional presence through multiple offices. The target audience includes construction clients and partners within the real estate and building sectors in Austria. Technically, the website is built on WordPress with common plugins and frameworks, including Visual Composer and Slider Revolution, and integrates Google Analytics and marketing pixels for user tracking. However, the site suffers from slow performance and outdated SSL/TLS configuration, lacking a valid HTTPS certificate, which is a critical security concern. Privacy compliance is well addressed with a comprehensive cookie consent mechanism and GDPR-aligned privacy policy. Contact information is clearly provided with multiple channels and locations. Overall, the website is professional and trustworthy but requires urgent security improvements to protect user data and enhance trust.

15
-
5
50
-
85
20
constructiongeneralcontractoraustriaisocertifiedrealestate+3 more
WordPressPHPjQueryAngularJS 1.4.8+5
2025-06-15T21:50:34.841Z
polytechnik.com favicon

Polytechnik Luft- und Feuerungstechnik GmbH

polytechnik.com

24
EnergyAustriamediumCRITICAL

Polytechnik Luft- und Feuerungstechnik GmbH is a well-established Austrian company specializing in biomass energy technologies, with over 60 years of experience and a global footprint in 25 countries. The company offers advanced solutions for transforming biomass into CO2-neutral energy, including combustion, gasification, carbonization, and torrefaction technologies. Their market position is strong, supported by a medium-sized workforce and a comprehensive product portfolio. The website reflects a professional and content-rich digital presence, targeting industrial and energy sector clients seeking sustainable energy solutions. Technically, the website is built on WordPress with modern SEO and multilingual plugins, ensuring good accessibility and mobile optimization. However, performance metrics are lacking, and the absence of DNS A/AAAA records raises questions about hosting and domain resolution. The site uses common JavaScript libraries and cookie consent management tools, indicating a mature digital infrastructure. From a security perspective, the site suffers from a critical issue: the SSL certificate is invalid or missing, which undermines HTTPS security and user trust. Additionally, no DNS records are publicly visible, and security headers are minimal. While no major vulnerabilities are detected, the lack of a valid SSL certificate and absence of advanced security policies reduce the overall security posture. Overall, the website is credible and professional but requires urgent security improvements, especially regarding SSL/TLS configuration and DNS setup, to enhance trust and compliance. Privacy policies and cookie consent mechanisms are well implemented, supporting GDPR compliance. Strategic recommendations include obtaining a valid SSL certificate, improving DNS configurations, and publishing explicit security and incident response policies.

15
18
5
50
-
50
20
biomassenergysustainabilitytechnologyrenewableenergy+2 more
ApacheWordPressYoast SEOjQuery+4
2025-06-15T21:49:55.404Z
superangels.club favicon

European Super Angels Club

superangels.club

43
TechnologyAustriasmallHIGH

European Super Angels Club is a pan-European investment club targeting business angels, high-net-worth individuals, family offices, and corporate venture capital units. It facilitates investments in technology startups, particularly in smart mobility, by providing access to curated deals, due diligence support, and a strong network of partners and co-investors. The website presents a professional image with detailed information about membership benefits, partners, and events, positioning itself as a key player in the European startup investment ecosystem. Technically, the website is built on WordPress using the Enfold theme and integrates various plugins for SEO, analytics, and content presentation. However, the site suffers from slow load times and lacks a valid SSL certificate, which is a critical security flaw. The absence of modern TLS protocols and security headers further weakens its security posture. The site is mobile-optimized and SEO-friendly but lacks cookie consent mechanisms despite using tracking tools. From a security perspective, the lack of HTTPS and security headers exposes users to risks and undermines trust. The WHOIS data shows a mature domain with privacy protection justified by the business nature. No WAF or blocking mechanisms are detected, allowing full content access. Overall, the site demonstrates moderate business credibility but requires urgent security improvements to protect users and enhance trust. Strategically, the club should prioritize SSL implementation, enhance security headers, and introduce privacy compliance features such as cookie consent to align with GDPR. Improving site performance and accessibility will also benefit user experience and SEO rankings.

15
43
25
50
75
75
40
investmentstartupbusinessangelsventurecapitaleurope+2 more
WordPressEnfold ThemeYoast SEOGoogle Analytics (ExactMetrics plugin)+4
2025-06-15T21:49:37.113Z
spenglerfox.com favicon

SpenglerFox

spenglerfox.com

40
OtherN/alargeHIGH

SpenglerFox is a globally recognized executive search and talent solutions provider, ranked in the top 40 worldwide. The company operates through a large network of over 380 consultants across 76 offices in 47 countries, offering services including executive search, leadership advisory, interim management, recruitment process outsourcing, and board solutions. Their business model focuses on delivering agile talent solutions to corporate clients seeking leadership and executive talent globally. The website content is professionally crafted, with detailed service descriptions and team profiles, reflecting a mature and established business. Technically, the website is built on WordPress, leveraging common plugins such as Yoast SEO and includes integrations with analytics and tracking tools like Microsoft Clarity, Google Tag Manager, and LinkedIn Insight. The site uses Apache hosting with DNS managed via AWS Route53. However, the website lacks HTTPS encryption, which is a critical security shortfall. Performance is moderate to slow, with good mobile optimization and basic accessibility features. From a security perspective, the absence of a valid SSL certificate and HTTPS is a major vulnerability, exposing users to potential data interception risks. The site also lacks important security headers and cookie consent mechanisms, which are important for GDPR compliance and user privacy. No incident response or security policy pages are found, and no certifications are displayed. The domain registration is consistent and transparent, with a mature domain age of 22 years and strong domain protection, supporting the legitimacy of the business. Overall, while the business and content quality are high, the security posture is weak due to missing HTTPS and security headers. Strategic improvements in SSL deployment, security headers, and privacy compliance are recommended to enhance trust and protect user data.

20
18
5
50
-
85
100
executivesearchtalentsolutionsleadershipadvisoryrecruitmentglobal+1 more
ApacheWordPressYoast SEOjQuery+3
2025-06-15T21:49:14.473Z
ait.com favicon

Advanced Internet Technologies

ait.com

40
TechnologyUnited StatesmediumHIGH

Advanced Internet Technologies (AIT) is a mature and established technology company specializing in domain registration, web hosting, digital marketing, web design, security, and e-commerce solutions. With a domain age of 27 years and strong domain protection, AIT positions itself as a reliable service provider targeting businesses seeking comprehensive online presence solutions. The website reflects a professional design with clear navigation and a focus on customer support, including 24/7 availability and multiple contact channels. Technically, the website is built on WordPress using the Divi theme and integrates modern libraries such as jQuery and Bootstrap. It leverages Cloudflare for hosting and CDN services, and employs SEO and marketing tools like Yoast SEO Premium and WP Rocket. However, the site lacks a valid SSL certificate, which is a critical security gap, and does not implement cookie consent mechanisms, impacting privacy compliance. Security posture is moderate with several security headers configured, but the absence of HTTPS and TLS protocols significantly reduces the security score. No major vulnerabilities like Heartbleed or POODLE were detected, but improvements are needed to meet modern security standards. Business credibility is high, supported by consistent WHOIS data, customer testimonials, and active social media presence. Overall, while AIT demonstrates strong business credibility and technical maturity, urgent attention to SSL/TLS implementation and privacy compliance is recommended to enhance security and user trust.

90
-
-
50
-
85
100
webhostingdomainregistrationdigitalmarketingwebdesignsecurity+2 more
PHP 8.2.28jQuery 3.7.1Bootstrap 3.4.1Bootstrap 4.3.1+7

Partner Domains:

aitdomains.com
servicepending
aitcom.net
servicepending

+1 more partners

2025-06-15T21:49:13.406Z
eurocom.at favicon

Eurocom Translation Services GmbH

eurocom.at

27
ManufacturingAustriamediumHIGH

Eurocom Translation Services GmbH is a well-established B2B translation and language service provider based in Austria, with over 30 years of experience and a strong market presence in the DACH region. The company offers a comprehensive suite of services including technical and marketing translations, terminology management, quality management, and language managed services such as Global SEO and machine translation. Eurocom is part of the Kaleidoscope Group, which enhances its technological capabilities and market reach. The website reflects a professional and content-rich digital presence, targeting export-oriented businesses seeking multilingual content solutions. Technically, the site is built on WordPress with modern plugins and tools, but suffers from a critical security shortfall due to the absence of a valid SSL certificate, resulting in no HTTPS support. Privacy compliance is well addressed with a comprehensive privacy policy and cookie consent mechanism. The security posture is basic, lacking important security headers and DNS security features. Overall, Eurocom demonstrates strong business credibility and digital maturity but must urgently address its SSL/TLS configuration to improve security and trustworthiness.

70
-
5
50
-
85
-
translationb2blanguageservicesisocertifiedmultilingual+2 more
WordPressPHPjQueryContact Form 7+9

Partner Domains:

kaleidoscope.at
parent27
congram.at
subsidiarypending
2025-06-15T21:49:12.170Z