Skip to main content

Transportation security reports

Browse 7,552 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

155884
Websites
130
Industries
113
Countries
52
Avg Score
Page 5 of 152|Showing 201-250 of 7552
londontravelwatch.org.uk favicon

London TravelWatch

londontravelwatch.org.uk

62
TransportationUnited KingdommediumMEDIUM

London TravelWatch operates as the statutory transport watchdog for London, advocating on behalf of the public to improve transport services across the capital. The organization maintains a strong market position as an independent watchdog, partnering with Transport Focus to enhance its reach and effectiveness. Their key services include transport advocacy, handling complaints, conducting research, and providing public advice. The website reflects a professional and trustworthy image with consistent branding and comprehensive content tailored to London transport users and stakeholders. Technically, the website is built on WordPress with a modern tech stack including jQuery, Yoast SEO, Algolia Search, and Plausible Analytics. It demonstrates good performance, mobile optimization, accessibility, and SEO practices. The site uses HTTPS and includes cookie consent mechanisms aligned with GDPR requirements, reflecting a mature digital infrastructure. From a security perspective, the site enforces HTTPS and employs cookie consent with denied personalization and tracking by default. While explicit security headers are not fully confirmed, no vulnerabilities or exposed sensitive data were detected. The absence of a security.txt or vulnerability disclosure page is noted as an area for improvement. Overall, the security posture is solid but could be enhanced with additional headers and formal vulnerability disclosure. The WHOIS data is unavailable due to domain naming rules errors, limiting direct verification of domain registration details. Despite this, the website content, certifications, and partner references strongly indicate legitimacy. The overall risk is low, but the lack of WHOIS transparency slightly reduces trustworthiness. Strategic recommendations include improving security headers, publishing a security.txt file, and ensuring WHOIS data availability or transparency to enhance domain trust.

27
100
85
70
100
2
30
transportadvocacylondonpublicservicenon-profit+2 more
WordPressjQueryYoast SEOAlgolia Search+3

Partner Domains:

transportfocus.org.uk
partner
2026-07-10T07:24:46.519Z
essex-commercial.co.uk favicon

Essex Commercial

essex-commercial.co.uk

49
TransportationUnited KingdomsmallHIGH

Essex Commercial is a UK-based small business specializing in commercial vehicle body repairs and resprays, serving clients primarily in Essex and surrounding areas. The company offers services for lorries, trucks, vans, and horse boxes, positioning itself as a local specialist with a focus on quality and customer satisfaction. The website reflects a professional and consistent brand image with clear contact details and client trust indicators such as logos from recognized brands. Technically, the website employs a modern JavaScript stack including jQuery, Modernizr, Google reCAPTCHA, and Google Tag Manager for analytics and spam protection. The site is mobile-optimized with good SEO practices but lacks visible advanced security headers and explicit cookie consent mechanisms. Performance is moderate, and accessibility is basic. From a security perspective, the site uses HTTPS and Google reCAPTCHA but does not show evidence of comprehensive security headers or incident response policies. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy. However, the website content and contact information suggest a legitimate business operation. Overall, the website scores moderately well in content quality, technical implementation, and business credibility but has room for improvement in security posture and privacy compliance. Strategic recommendations include enhancing security headers, implementing cookie consent, verifying domain registration, and publishing clear security and privacy policies.

20
60
57
85
68
30
2
commercialvehiclerepairbodyworkresprayessexvehiclerepair+1 more
jQuery 3.6.0Modernizr 3.11.2Google reCAPTCHAGoogle Tag Manager+4
2026-07-10T07:20:31.666Z
hippowaste.co.uk favicon

Waste Management Systems Ltd.

hippowaste.co.uk

67
TransportationUnited KingdommediumMEDIUM

HIPPO, operated by Waste Management Systems Ltd., is a well-established UK-based rubbish removal service provider with over 20 years of experience. The company offers a variety of waste disposal solutions including HIPPOBAG, Man and Van, Skip Hire, and trade waste services, targeting both residential and business customers across the UK. Their market position is strong, supported by certifications such as ISO14001 and ISO9001, and a high customer satisfaction rating on Trustpilot. The website reflects a professional and trustworthy brand with consistent branding and comprehensive service information. From a technical perspective, the website employs modern web technologies including jQuery, Google Tag Manager, Trustpilot widgets, and OneTrust for cookie consent management. The site is mobile-optimized with good SEO practices and moderate performance. Security posture is generally good with HTTPS enforced and cookie consent mechanisms in place, though some security headers are not explicitly detected and no public security policy or incident response contacts are found. The WHOIS data for the domain is incomplete and indicates an error related to domain naming rules, likely due to querying the 'www' subdomain instead of the root domain. Despite this, the website content and business information appear legitimate and professional. No adult or NSFW content is present, and privacy compliance is well addressed with clear policies and consent banners. Overall, HIPPO presents a credible and professional online presence with strong business credibility and good technical implementation. Security can be improved by adding explicit security headers and publishing incident response information. The WHOIS discrepancy should be clarified by querying the correct domain name.

77
65
100
75
2
73
65
rubbishremovalwastemanagementskiphirehippobagmanandvan+3 more
jQueryGoogle Tag ManagerTrustpilot WidgetOneTrust Cookie Consent+2
2026-07-10T07:18:06.232Z
C

Car Concierge

carconciergeservice.co.uk

46
TransportationUnited KingdomsmallHIGH

Car Concierge, operating under the brand Abels Car Concierge Service, is a UK-based company specializing in premium vehicle storage, transportation, and shipping services. Established since at least 2010, the company holds a prestigious Royal Warrant, underscoring its reputation for quality and reliability. The website clearly targets vehicle owners seeking secure and professional car storage and transport solutions across the UK, Europe, and worldwide. The business model focuses on service provision with a strong emphasis on trust and heritage. Technically, the website is built on WordPress with a moderate technology stack including popular plugins for analytics, forms, and UI enhancements. The site is moderately optimized for performance and mobile use, with good SEO practices evident in metadata and structured data. However, accessibility and advanced mobile optimization are basic. Security posture is adequate with HTTPS enforced and no exposed sensitive data, but lacks advanced HTTP security headers and visible security policies. From a security and compliance perspective, the site does not display explicit privacy or cookie consent mechanisms, which may pose GDPR compliance risks. There is no published incident response or vulnerability disclosure information. The domain registration data aligns well with the business claims, supporting legitimacy. Overall, the site is professional and trustworthy but could improve in privacy compliance and security transparency. Strategically, the company should prioritize implementing cookie consent and privacy enhancements, publish clear security policies, and adopt security headers to strengthen its security posture and regulatory compliance. These improvements will enhance customer trust and reduce risk exposure.

47
85
60
20
15
58
2
carstorageluxurycartransportclassiccartransportationcarshippingvehicleremovals+2 more
WordPressPHPjQueryGoogle Analytics+6

Partner Domains:

abels.co.uk
partner
blueskycreativeuk.com
partner
2026-07-10T07:16:19.909Z
silvershieldwindscreens.co.uk favicon

Silver Shield Windscreens

silvershieldwindscreens.co.uk

50
TransportationUnited KingdomsmallMEDIUM

Silver Shield Windscreens is a UK-based company specializing in automotive glass repair and replacement services, including windscreen repairs, replacements, fleet services, specialist glazing, and ADAS recalibration. The company targets fleet owners, business owners, and private vehicle owners across England and Wales, emphasizing quality service at competitive prices with trained technicians and insurance claim support. The website presents a professional image with clear contact details and service descriptions. Technically, the website employs legacy technologies such as jQuery 1.8.3 and Modernizr 2.6.2, alongside Google Analytics and Tag Manager for tracking. The site is mobile-optimized with a cookie consent mechanism, but lacks visible modern security headers and uses an outdated JavaScript library, which may pose security risks. Performance is moderate, and SEO practices are adequately implemented. From a security perspective, the site uses HTTPS (assumed from external scripts loaded via HTTPS), but no explicit security headers were detected in the provided data. The cookie consent banner and privacy policies indicate GDPR compliance efforts, though no incident response or vulnerability disclosure information is present. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy, though the website content is consistent with a legitimate business. Overall, the website is functional and professional but would benefit from technical and security improvements, including updating libraries, implementing security headers, and clarifying domain registration status to enhance trust and compliance.

47
60
85
20
15
95
2
windscreenrepairwindscreenreplacementfleetservicesadasrecalibrationspecialistglazing+3 more
jQuery 1.8.3Google AnalyticsGoogle Tag ManagerModernizr 2.6.2+1
2026-07-10T07:09:34.977Z
directvehicleglass.co.uk favicon

Direct Vehicle Glass

directvehicleglass.co.uk

46
TransportationUnited KingdommediumHIGH

Direct Vehicle Glass is a well-established UK-based company specializing in mobile windscreen repair and replacement services, primarily serving Liverpool, Warrington, Manchester, and the wider North West region. The company positions itself as a leading independent automotive glazing provider with a focus on quality and responsiveness. Their key services include private and commercial vehicle glass repair, fleet cover, and advanced driver assistance system (ADAS) calibration. The website reflects a medium-sized business with a professional online presence and multiple insurance partnerships that enhance trustworthiness. Technically, the website is built on WordPress and utilizes modern web technologies such as jQuery, Slick Carousel, and Google Analytics for tracking. The site is mobile-optimized with good SEO practices implemented via Yoast SEO. Performance is moderate, and accessibility is basic but functional. The site uses HTTPS with an excellent SSL configuration, though it lacks some security headers that could improve its security posture. From a security perspective, the site demonstrates good baseline practices such as HTTPS and no visible sensitive data exposure. However, it lacks published security policies, incident response information, and a cookie consent mechanism, which are important for GDPR compliance and user trust. No vulnerabilities or suspicious content were detected. The domain registration data aligns well with the business claims, indicating legitimacy and a strong trust foundation. Overall, the website is professional, credible, and secure enough for its business purpose but would benefit from enhanced privacy compliance and security transparency to improve user trust and regulatory adherence.

70
65
20
47
53
17
15
windscreenrepairvehicleglassmobileserviceadascalibrationfleetcover+4 more
jQuerySlick CarouselGoogle AnalyticsYoast SEO
2026-07-10T07:07:53.481Z
traffixuk.com favicon

Traffix Ltd

traffixuk.com

61
TransportationUnited KingdommediumMEDIUM

Traffix Ltd is a well-established UK-based company specializing in temporary traffic and event management services. Operating since 2005 with a domain registered in 2006, the company maintains a strong market position in the transportation sector, serving complex infrastructure projects, construction, highway maintenance, utilities, and high-profile events. Their service portfolio is comprehensive, supported by multiple strategically located depots and a 24/7 emergency callout service. The website reflects a professional and consistent brand image with clear navigation and relevant content targeting businesses and organizations requiring traffic management solutions in Central England and beyond. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, WPBakery Page Builder, and Slider Revolution. It employs Google Analytics and Facebook Pixel for analytics and marketing, and implements cookie consent mechanisms aligned with GDPR requirements. Hosting is provided by s2hosting.co.uk, and the site shows good mobile optimization and moderate performance. Security posture is solid with HTTPS enabled and reCAPTCHA on forms, though improvements could be made by enabling DNSSEC and adding security headers. No WAF or blocking mechanisms were detected, allowing full content access. The WHOIS data is consistent with the business claims, showing a long domain age and transparent registration without privacy protection, supporting legitimacy. Contact information is clearly presented with multiple phone numbers, emails, and physical addresses. Social media presence is active across major platforms, enhancing trust and outreach. Overall, Traffix Ltd demonstrates a mature digital presence with good security and privacy compliance, making it a trustworthy and professional service provider in its industry.

60
100
85
27
45
85
2
trafficmanagementeventmanagementtransportationukbusinesswordpress+3 more
WordPressPHPYoast SEO pluginWPBakery Page Builder+7
2026-07-10T07:07:42.790Z
gtwholesale.co.uk favicon

Group Tyre Wholesale Limited

gtwholesale.co.uk

55
TransportationUnited KingdommediumMEDIUM

Group Tyre Wholesale Limited is a UK-based tyre wholesaler established in 2010, specializing in supplying a wide range of tyres for cars, vans, and 4x4 vehicles. The company targets automotive trade professionals and garages, offering trade online ordering, account management, and employee training resources. Their market position is supported by over 14 years of operation, a large stock inventory, and a dedicated delivery fleet. Technically, the website is built on WordPress using the Divi theme, leveraging common web technologies such as jQuery and PHP. The site demonstrates moderate performance and good mobile optimization but could improve accessibility and SEO. Security posture is solid with HTTPS and DNSSEC enabled, though additional HTTP security headers and published security policies would enhance trust. Privacy compliance is well addressed with clear cookie and privacy policies and a consent mechanism. Overall, the website is professional and trustworthy, with clear business information and contact channels, though no direct company emails were found. Strategic recommendations include enhancing security headers, publishing incident response information, and improving SEO and accessibility.

47
70
85
20
2
50
85
tyreswholesaleruktradeautomotive+1 more
WordPressDivi ThemejQueryPHP

Partner Domains:

gtw3.thevirtualwarehouse.co.uk
partner
grouptyrewholesale.astute-elearning.com
partner

+1 more partners

2026-07-09T07:22:32.585Z
fms-logistics.com favicon

Fr. Meyer's Sohn (GmbH & Co.) KG

fms-logistics.com

59
TransportationGermanylargeMEDIUM

Fr. Meyer's Sohn (GmbH & Co.) KG is a well-established global freight forwarding company headquartered in Hamburg, Germany, with over 125 years of experience. The company specializes in ocean freight, air freight, and land transportation, positioning itself among the top 10 ocean freight forwarders worldwide. Their business model focuses on providing customized logistics and supply chain solutions, leveraging digital tools such as their SCM solution 'Cruise Control' to streamline logistics processes. The website targets businesses requiring comprehensive freight and logistics services globally. Technically, the website is built on the TYPO3 CMS platform, utilizing modern web technologies including JavaScript and CSS. The site demonstrates good mobile optimization, accessibility, and SEO practices, with a professional design and clear navigation. Cookie consent and privacy compliance mechanisms are implemented, reflecting a mature digital infrastructure. From a security perspective, the site enforces HTTPS and employs secure form practices. However, it lacks visible HTTP security headers and does not provide explicit security policies or incident response contacts, which are areas for improvement. The absence of WHOIS data for the domain raises some concerns about domain registration transparency, although the website content and branding strongly indicate a legitimate business. Overall, the website presents a professional and trustworthy front for a large logistics company, with strong content quality and technical implementation. Addressing the WHOIS transparency and enhancing security disclosures would further strengthen their security posture and trustworthiness.

85
80
79
40
40
2
65
logisticsfreightforwardingtransportationsupplychaindigitalsolutions+1 more
TYPO3 CMSJavaScriptCSSHTML5
2026-07-08T07:25:13.661Z
P

PGS Global Logistics Ltd.

pgsglobal.co.uk

54
TransportationUnited KingdommediumMEDIUM

PGS Global Logistics Ltd. is a UK-based logistics company with over 30 years of experience, offering a comprehensive range of services including UK distribution, haulage, global forwarding, warehousing, supply chain solutions, and driver training. The company operates multiple depots in the UK and targets businesses requiring reliable logistics and supply chain management solutions. Their website reflects a professional and consistent brand image with clear navigation and relevant content tailored to their business audience. Technically, the website employs modern JavaScript technologies and integrates Google Analytics and Tag Manager for tracking, with cookie consent mechanisms denying tracking by default, indicating a privacy-conscious approach. Security posture is moderate; HTTPS is enforced, but security headers and incident response information are lacking. The WHOIS data is unavailable due to domain registration errors, which raises some concerns about domain legitimacy, but the website content and contact information appear authentic and professional. Overall, the website presents a trustworthy and credible business presence with room for security and compliance improvements.

69
20
70
65
60
2
68
logisticswarehousingdistributionuktransportation+2 more
Google AnalyticsGoogle Tag ManagerResponsive JavaScriptCustom JavaScript modules

Partner Domains:

pgs.vigoportal.com
partner
apc.hypaship.com
partner

+1 more partners

2026-07-08T07:24:09.781Z
C

City Cabs (Edinburgh) Ltd

citycabs.co.uk

49
TransportationUnited KingdommediumHIGH

City Cabs (Edinburgh) Ltd is a well-established transportation service provider specializing in licensed black cab taxi services in Edinburgh and over 50 UK cities. Founded in 1925, the company leverages a proprietary app to facilitate instant booking, live driver tracking, and secure payments, serving over 110,000 app users and completing more than 1.5 million journeys annually. The business maintains a strong local presence with a focus on professionalism, licensing compliance, and customer trust, supported by positive testimonials and a clear brand identity. Technically, the website is built on WordPress using modern frameworks such as Bootstrap and WPBakery Page Builder, with integrated SEO and analytics tools including Yoast SEO, Google Analytics, and Facebook Pixel. The site is mobile-optimized, performant, and well-structured, providing a seamless user experience. However, some security best practices like explicit security headers and incident response information are not present. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data, but lacks published security policies or vulnerability disclosure mechanisms. The WHOIS data for the domain is unavailable due to a Nominet UK registration error, which raises questions about domain registration transparency but does not detract from the apparent legitimacy of the business based on website content and branding. Overall, City Cabs presents a professional and trustworthy online presence with room for improvement in security transparency and WHOIS clarity. Strategic recommendations include enhancing security headers, publishing incident response contacts, and clarifying domain registration details to bolster trust and compliance.

65
70
20
47
2
15
88
transportationtaxiedinburghlicensedblackcabsappbooking+1 more
WordPressWPBakery Page BuilderYoast SEO PremiumGoogle Tag Manager+5

Partner Domains:

booker.cab9.app
partner
2026-07-08T07:10:04.235Z
durhamcitytransport.com favicon

Durham City Transport Ltd

durhamcitytransport.com

50
TransportationUnited KingdomsmallMEDIUM

Durham City Transport Ltd is a family-run haulage and distribution company based in County Durham, UK, specializing in domestic transport, storage, and logistics services. The company positions itself as a regional service provider with a focus on prompt and reliable logistics solutions, supported by a fleet of 44-tonne curtain-sided trailers and a 30,000 square foot storage facility. The website reflects a professional and consistent brand image, targeting UK businesses requiring haulage and storage services. Technically, the website employs a range of established JavaScript libraries and plugins such as jQuery, Owl Carousel, bxSlider, and FontAwesome, alongside Google Analytics and ShareThis for tracking and social sharing. The site is mobile-optimized with responsive design elements and basic accessibility features. SEO practices are adequately implemented with proper meta tags and structured data. From a security perspective, the site uses HTTPS but lacks visible HTTP security headers and explicit security or incident response policies. Cookie consent and privacy policy are present, indicating GDPR compliance awareness. However, the absence of WHOIS data for the domain raises concerns about domain registration legitimacy, which impacts overall trustworthiness. Overall, the website presents a solid business front with good content quality and technical implementation but requires improvements in security posture and domain registration transparency to enhance trust and compliance.

52
85
-
75
83
2
30
transportlogisticsstoragehaulageuk+3 more
jQueryjQuery UIOwl CarouselbxSlider+4
2026-07-08T07:08:54.748Z
fmconway.co.uk favicon

FM Conway Limited

fmconway.co.uk

68
TransportationUnited KingdomlargeMEDIUM

FM Conway Limited is a leading UK infrastructure services provider specializing in transportation, civil engineering, and construction materials manufacturing, particularly asphalt. The company holds a strong market position in the South East of England and offers a broad range of services including aggregates, consultancy, highways maintenance, lighting, major projects, and traffic management. The website reflects a professional and comprehensive digital presence with detailed service descriptions, multimedia content, and active social media engagement. Technically, the site uses modern frameworks such as Bootstrap and jQuery, with good mobile optimization and SEO practices. Security posture is generally good with HTTPS enforced and cookie consent implemented, though some security headers are missing and no explicit incident response or vulnerability disclosure information is found. WHOIS data could not be retrieved for the queried subdomain, but the overall business credibility and trust indicators on the site are strong. Strategic recommendations include enhancing security headers, publishing incident response contacts, and adding vulnerability disclosure mechanisms to improve security transparency and compliance.

65
64
70
100
68
22
75
infrastructureconstructionasphaltcivilengineeringsustainability+2 more
BootstrapjQueryGoogle FontsYouTube iframe API

Partner Domains:

careers.fmconway.co.uk
subsidiary
2026-07-08T07:08:12.261Z
S

Seven Club Ltd

lotus7.club

49
TransportationUnited KingdomsmallHIGH

The domain caterhamlotus7.club is registered to Seven Club Ltd, a UK-based small business established in 2021, likely operating in the transportation sector given the domain name. However, the website content is currently inaccessible due to network restrictions or a web application firewall (WAF) blocking access, presenting a significant barrier to assessing the company's digital presence and offerings. The WHOIS data is transparent and consistent with the business identity, but no website content, metadata, or contact information is available for further analysis. Technically, the site lacks accessible content, metadata, or detectable technologies, preventing a full evaluation of its infrastructure or digital maturity. The hosting provider is Gandi SAS, a reputable registrar and hosting provider. The absence of DNSSEC and security headers, combined with the blocked content, suggests room for improvement in security configuration. From a security perspective, the inability to access the site limits the assessment of security posture, privacy compliance, and incident response readiness. No privacy or cookie policies are found, and no contact or security-related information is available. The domain registration is legitimate and consistent with the business, but the lack of accessible content and security best practices lowers trust and credibility. Overall, the site scores low on content quality, technical implementation, security posture, privacy compliance, and business credibility due to the blocking and lack of accessible information. Strategic recommendations include enabling proper HTTPS and security headers, publishing privacy and cookie policies, providing clear contact and incident response information, and ensuring the website is accessible to users and security scanners.

70
70
42
100
17
40
35
2026-07-08T07:06:52.781Z
seagoyachting.co.uk favicon

Seago Yachting Ltd

seagoyachting.co.uk

63
TransportationUnited KingdommediumMEDIUM

Seago Yachting Ltd is a UK-based company established in 2003, specializing in maritime leisure and commercial safety products including lifejackets, liferafts, and ropes. The company has grown to become a recognized leader in the leisure sailing market and has expanded into the commercial maritime sector with MCA-approved and ISO/SOLAS-compliant products. Their business model focuses on distribution and service provision, including life raft hire, targeting leisure sailors and commercial maritime operators. The website reflects a professional and consistent brand with clear product categories and certifications, supporting their market position. Technically, the website is built on the Webflow platform, utilizing modern web technologies such as Google Tag Manager, jQuery, and Cognito Forms for data collection. The site is mobile-optimized with good SEO practices and moderate performance. However, some accessibility features could be improved. Security posture is strong with HTTPS enforced and no visible vulnerabilities, though security headers and explicit security policies are absent. The absence of WHOIS data is a notable concern, as it limits verification of domain legitimacy and registration details. Despite this, the website content and business information appear credible and trustworthy. Privacy and cookie policies are present, but the lack of a cookie consent mechanism suggests partial GDPR compliance. Social media presence and certifications further enhance trust. Overall, the site presents a solid digital presence for Seago Yachting Ltd, but improvements in transparency of domain registration, security policies, and privacy compliance would strengthen their security posture and trustworthiness.

37
80
75
100
60
2
68
maritimeleisurecommerciallifejacketsliferafts+3 more
Webflow CMSGoogle Tag ManagerjQueryPopper.js+2

Partner Domains:

my.seagogroup.com
service
fountaindigital.co.uk
partner
2026-07-06T07:20:49.179Z
amesford.com favicon

Ames Ford Lincoln

amesford.com

62
TransportationUnited StatesmediumMEDIUM

Ames Ford Lincoln operates as a regional automobile dealership specializing in new and used Ford vehicles, serving Ames, Iowa, and surrounding areas including Ankeny, Marshalltown, and Des Moines. The website presents a professional and consistent brand image aligned with Ford dealership standards, targeting local car buyers. The business model focuses on vehicle sales and related services, positioning itself as a prominent local dealership in the transportation and retail sectors. Technically, the website leverages the DealerOn platform with Bootstrap and FontAwesome for UI components, and includes tracking scripts such as CrazyEgg for analytics and user behavior insights. The site demonstrates moderate performance and good mobile optimization, though accessibility features are basic. SEO practices are adequately implemented with proper meta tags and Open Graph data. From a security perspective, the site lacks visible security headers and explicit privacy or cookie policies, which are critical for compliance and user trust. The absence of WHOIS registration data raises concerns about domain legitimacy and ownership transparency. No WAF or blocking mechanisms were detected, and the site content is accessible without restrictions. No adult or questionable content is present, making the site safe for general audiences. Overall, the website is functional and professionally presented but requires improvements in security posture, privacy compliance, and domain registration transparency to enhance trustworthiness and regulatory adherence.

57
70
75
100
40
17
73
automobilecardealershipfordusedcarsnewcars+1 more
JavaScriptBootstrap 3.4.7FontAwesomeDealerOn platform scripts
2026-07-06T07:16:10.937Z
motormechguildford.co.uk favicon

Motormech Guildford Limited

motormechguildford.co.uk

58
TransportationUnited KingdomsmallMEDIUM

Motormech Guildford Limited is a small, local automotive service provider based in Guildford, UK, specializing in vehicle servicing, MOT testing, air conditioning recharge, tyre fitting, and general vehicle repairs. The company positions itself as a trusted local garage with Bosch accreditation and Trust My Garage membership, targeting local vehicle owners seeking reliable and professional car maintenance services. The website content is well-structured, informative, and professionally presented, with clear service offerings and pricing, supporting a positive market position in the local transportation sector. The technical infrastructure is built on WordPress CMS, utilizing common plugins such as Contact Form 7, Smart Slider 3, and WP Review Slider Pro. The site integrates Google Analytics, Google Tag Manager, and Facebook Pixel for marketing and analytics purposes. Performance and mobile optimization are good, though accessibility features are basic. SEO is well addressed with proper meta tags and structured data. Security posture is adequate with HTTPS enabled and no exposed sensitive data, but lacks advanced security headers and a vulnerability disclosure policy. Privacy compliance is limited due to the absence of visible privacy and cookie policies or consent mechanisms. The WHOIS data confirms domain legitimacy and consistency with business claims, supporting a high trust level. Overall, the website is professional and trustworthy but would benefit from enhanced privacy compliance and security best practices to improve user trust and regulatory adherence.

70
65
32
100
15
17
85
automotivecarservicingmottestinglocalgaragevehiclerepair+2 more
WordPressPHPjQuerySmart Slider 3+5
2026-07-06T07:11:49.608Z
W

Whitcher Wildlife Ltd

whitcher-wildlife.co.uk

46
TransportationUnited KingdomsmallHIGH

Whitcher Wildlife Ltd is a family-run ecological consultancy based in the United Kingdom, specializing in practical ecology surveys and environmental advice across infrastructure, industry, and private sectors. Established since 1998, the company positions itself as a trusted provider delivering high-quality ecological services including species-specific surveys, ecological impact assessments, and biodiversity net gain assessments. Their client base includes reputable organizations and local councils, indicating a strong market presence in the UK ecological consultancy sector. Technically, the website is built on OctoberCMS and leverages modern web technologies such as GSAP for animations, Owl Carousel for content display, and Google Analytics with IP anonymization for user insights. The site is mobile-optimized with good SEO practices and a professional design, providing a positive user experience. Cookie consent mechanisms and a comprehensive privacy policy demonstrate attention to privacy compliance. From a security perspective, the website enforces HTTPS and employs privacy-conscious analytics configurations. However, the absence of visible security headers and lack of explicit security or incident response policies suggest areas for improvement. The WHOIS data for the domain is unavailable due to a domain registration error from Nominet UK, which raises some concerns about domain legitimacy, although the website content and business information appear credible. Overall, the website presents a professional and trustworthy front for Whitcher Wildlife Ltd, but the domain registration anomaly and minor security header omissions should be addressed to enhance trust and security posture.

20
57
60
70
15
68
2
ecologyconsultancywildlifeenvironmentuk+2 more
HTML5CSS3JavaScriptjQuery (implied by owl-carousel usage)+4
2026-07-06T07:10:30.578Z
greenshieldsjcb.com favicon

Greenshields JCB Ltd

greenshieldsjcb.com

54
TransportationUnited KingdommediumMEDIUM

Greenshields JCB Ltd is a leading UK dealer specializing in JCB construction and industrial machinery. The company offers a comprehensive range of services including new and used machine sales, parts supply, servicing, finance, and insurance. With a strong market position as the premier JCB dealer in the UK, Greenshields JCB targets construction and industrial sectors requiring reliable equipment and support. The website reflects a professional and consistent brand image, supported by active social media channels and detailed business information. Technically, the website is built on WordPress with WooCommerce and uses modern technologies such as Bootstrap 5, LayerSlider, and various tracking and marketing tools including Google Tag Manager and Facebook Pixel. The site is mobile-optimized with good SEO and accessibility basics, though there is room for improvement in accessibility compliance and security headers. Security posture is solid with HTTPS enforced, cookie consent management, and bot protection via Google reCAPTCHA. However, the absence of explicit security headers and lack of WHOIS data for the domain slightly reduce trustworthiness. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website presents a trustworthy and professional digital presence for Greenshields JCB Ltd, though the missing WHOIS information warrants caution. Strategic improvements in security headers and transparency around domain registration would enhance credibility and security posture.

70
20
57
70
17
100
20
jcbconstructionequipmentmachinerydealerukparts+4 more
WordPressWooCommerceEnfold ThemeLayerSlider+6
2026-07-05T07:23:32.953Z