Skip to main content

Other security reports

Browse 27,896 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157372
Websites
130
Industries
113
Countries
52
Avg Score
Page 336 of 558|Showing 16751-16800 of 27896
sunsetblvdinv.com favicon

Sunset Blvd. Investigations Inc.

sunsetblvdinv.com

58
OtherUnited StatessmallMEDIUM

Sunset Blvd. Investigations Inc. is a small, privately owned private investigation firm based in Los Angeles, California, with an additional office in Newport Beach. Founded in 2015, the company leverages over 80 years of combined law enforcement and investigative experience from its founders, who served as detectives in the LAPD and LASD. The firm offers a comprehensive suite of investigative services including surveillance, background checks, litigation support, and executive protection, targeting individuals and businesses requiring professional investigative assistance locally and globally. The website is professionally designed, mobile-optimized, and provides clear navigation and detailed service descriptions, enhancing user experience and trust. Technically, the website is built on WordPress using a PaperStreet theme, employing modern web technologies such as jQuery and Google reCAPTCHA for form security. The site enforces HTTPS, ensuring secure communications, but lacks some recommended security headers which could improve its security posture. Privacy compliance is partially addressed with a comprehensive privacy policy, though cookie policy and consent mechanisms are absent. Contact information is prominently displayed with multiple phone numbers and physical addresses, supporting business credibility. Security-wise, the site demonstrates good practices such as HTTPS and CAPTCHA protection on forms, but could benefit from enhanced security headers and published incident response policies. The absence of WHOIS data for the domain is a notable concern, reducing domain trustworthiness despite the professional appearance and content of the website. Overall, the site presents a trustworthy and professional front for a specialized investigative service provider, with room for improvement in security and privacy transparency.

15
53
17
70
52
75
100
privateinvestigatorlosangelesinvestigationslawenforcementsurveillance+2 more
jQuery 3.7.1Font: Roboto WOFF2Slick SliderYoast SEO (implied by Yoast schema)+1
2025-07-07T10:07:00.960Z
nocowboys.co.nz favicon

NoCowboys Limited

nocowboys.co.nz

57
OtherNew ZealandmediumMEDIUM

NoCowboys Limited operates an online platform dedicated to connecting New Zealand residents with trusted tradespeople and businesses, including builders, mechanics, painters, and plumbers. The website serves as a comprehensive rating and review site, positioning itself as the original Kiwi rating platform with a substantial number of user-generated ratings. Its business model revolves around facilitating informed decisions for consumers and providing marketing support for businesses through reputation management and job posting services. Technically, the website employs a modern JavaScript stack including jQuery, Google Tag Manager, Facebook SDK, and Google reCAPTCHA to enhance user interaction and security. The site is mobile-optimized with good SEO practices and a professional design, although accessibility features are basic. Performance is moderate, and the site uses HTTPS, but lacks some advanced security headers. From a security perspective, the site benefits from HTTPS and reCAPTCHA integration but lacks explicit security policies, incident response contacts, and cookie consent mechanisms, which are important for compliance and user trust. The absence of WHOIS data for the domain raises concerns about domain legitimacy and registration transparency, impacting overall trustworthiness. Overall, NoCowboys presents a professional and trustworthy front for its business niche but should address privacy compliance and security best practices to enhance user confidence and regulatory adherence.

30
35
17
70
65
65
100
tradespeoplebusinessreviewsnewzealandbuildersplumbers+4 more
jQueryjQuery UIGoogle Tag ManagerFacebook SDK+2
2025-07-07T07:54:35.959Z
S

Sitetech Solutions Ltd T/A SiteName

certified.co.nz

50
OtherNew ZealandsmallMEDIUM

The website certified.co.nz currently serves a default cPanel hosting placeholder page indicating that the site is not configured or has been moved. The domain is registered to Sitetech Solutions Ltd T/A SiteName, a hosting provider based in New Zealand, with a domain age dating back to 2000. There is no active business content, marketing information, or services presented on the site. The only contact information is a webmaster email address at the domain. From a technical perspective, the site uses Apache and cPanel technologies with DNS hosted on Cloudflare name servers. The page is basic and minimally optimized for mobile devices, with no detected CMS or advanced frameworks. There are no scripts, analytics, or tracking technologies present. Performance is moderate but limited by the lack of actual content. Security posture is weak due to the absence of HTTPS enforcement and security headers. The site exposes a default placeholder page which may leak information about server configuration. No privacy, cookie, or terms of service policies are present, indicating poor compliance with data protection regulations. No incident response or vulnerability disclosure information is available. Overall, the site represents an inactive or misconfigured domain with low trustworthiness and minimal business credibility. Strategic recommendations include properly configuring the website with HTTPS, removing default placeholder pages, implementing security best practices, and publishing privacy and cookie policies to improve compliance and user trust.

15
50
2
70
75
60
100
defaultpagehostingplaceholdercpanelsitemisconfiguration
ApachecPanelCloudflare DNS
2025-07-07T07:54:25.943Z
hunton.com favicon

Hunton Andrews Kurth LLP

hunton.com

73
OtherUnited StateslargeMEDIUM

Hunton Andrews Kurth LLP is a well-established global law firm with over 120 years of history, serving clients primarily in the energy, financial services, real estate, and retail sectors. The firm operates through 18 offices worldwide and employs over 900 professionals. Their business model focuses on providing comprehensive legal services with a collaborative approach, targeting corporate clients and industries requiring specialized legal expertise. The website reflects a mature digital presence with professional design, clear navigation, and extensive content that supports their market position as a leading law firm. Technically, the website employs modern web technologies including Google Tag Manager for analytics and OneTrust for cookie consent management, indicating a commitment to privacy compliance and user experience. The site is mobile-optimized, accessible, and SEO-friendly, though no specific CMS or hosting provider was identified. Performance is moderate, with good use of modern image formats and SVG graphics. From a security perspective, the site uses HTTPS with strong SSL configuration and includes security headers, enhancing protection against common web threats. However, there is no publicly available security policy or incident response information, nor a vulnerability disclosure program, which could be areas for improvement. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong, with clear privacy and cookie policies and consent mechanisms in place. Overall, the website presents a low-risk profile with high business credibility and professionalism. The absence of WHOIS data for the exact www.hunton.com domain is noted but does not detract from the legitimacy of the firm given the comprehensive and consistent website content. Strategic recommendations include publishing explicit security policies, establishing a vulnerability disclosure channel, and enhancing transparency around data protection officer contacts and certifications.

55
88
17
85
72
80
100
lawfirmlegalservicesenergyfinancialservicesrealestate+4 more
Google Tag ManagerOneTrust Cookie ConsentWebP imagesSVG graphics
2025-07-07T07:52:10.627Z
nglccny.org favicon

National LGBT Chamber of Commerce New York

nglccny.org

56
OtherUnited StatesmediumMEDIUM

The National LGBT Chamber of Commerce New York (nglccNY) serves as the New York Metro headquarters for the National LGBT Chamber of Commerce, a leading non-profit advocacy organization dedicated to expanding economic opportunities for the LGBT community. The organization focuses on certifying LGBT-owned businesses and advocating for their advancement in the marketplace. The website reflects a professional and consistent brand presence, targeting LGBT business owners and allies with services centered on certification and advocacy. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and integrates SEO tools like Yoast SEO. It uses Google Analytics and Tag Manager for tracking and marketing forms for engagement. The site is hosted on Azure CDN, indicating a reliable hosting infrastructure. Mobile optimization and SEO practices are good, though accessibility features are basic. From a security perspective, the site uses HTTPS as indicated by canonical URLs, but lacks visible security headers in the provided data. No exposed sensitive data or vulnerabilities were detected. Privacy and cookie policies are not explicitly found, which is a compliance gap. WHOIS data is privacy protected or unavailable, which is typical for non-profits but limits domain trust verification. Overall, the website presents a trustworthy and professional front for a non-profit advocacy organization with moderate technical maturity and some room for improvement in privacy compliance and security hardening. Strategic recommendations include implementing explicit privacy and cookie policies, enhancing security headers, and improving accessibility to strengthen trust and compliance.

30
35
10
70
62
65
100
lgbtbusinessnon-profitcertificationadvocacy+2 more
WordPressYoast SEOGoogle AnalyticsFontAwesome+2
2025-07-07T06:44:07.316Z
thebrandery.co.nz favicon

The Brandery

thebrandery.co.nz

60
OtherNew ZealandsmallMEDIUM

The Brandery is a small creative agency based in Auckland, New Zealand, specializing in graphic design, video production, animation, website design, and branding services. The company targets marketers and businesses across New Zealand and Australia, offering outsourced creative production to help clients regain workday efficiency. The website presents a professional image with a clear portfolio and client logos, indicating a solid market position among startups and industry leaders. Technically, the site is built on Squarespace, leveraging modern web technologies and integrating Google Analytics and Tag Manager for tracking. While the site is mobile-optimized and performs moderately well, there is room for improvement in accessibility and SEO. Security posture is adequate with HTTPS enforced, but lacks advanced security headers such as HSTS and CSP, which are recommended to enhance protection. Privacy compliance is basic, with no visible cookie consent mechanisms or comprehensive GDPR indicators. The absence of WHOIS data is a concern, reducing domain trustworthiness, though the website content suggests legitimacy. Overall, the site scores well in business credibility and content quality but should address security and privacy gaps to improve trust and compliance.

35
53
2
85
62
65
100
creativeagencybrandinggraphicdesignvideoproductionanimation+2 more
SquarespaceGoogle AnalyticsGoogle Tag ManagerTypekit Fonts+1
2025-07-07T06:40:51.452Z
bartlit-beck.com favicon

Bartlit Beck LLP

bartlit-beck.com

59
OtherUnited StatesmediumMEDIUM

Bartlit Beck LLP is a nationally recognized boutique law firm specializing in trial practice and corporate transactions. The firm targets corporate clients and individuals requiring high-stakes litigation and corporate legal services. Their business model emphasizes success-based fee arrangements and delivering exceptional client outcomes, supported by numerous industry awards and client testimonials. The website reflects a professional and consistent brand image with comprehensive content tailored to their target audience. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, with custom CSS and JavaScript for user experience enhancements. The site is mobile optimized, accessible, and SEO-friendly, though no CMS or hosting provider details are explicitly identified. Performance is moderate, with good navigation and content structure. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers and formal security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is notably missing or inaccessible, which raises some concerns about domain registration transparency, though the website content and professional presentation strongly indicate legitimacy. Overall, the site scores well on content quality, business credibility, and technical implementation, with room for improvement in security policy transparency and WHOIS data availability.

40
53
2
65
62
70
100
lawfirmlegalservicestrialpracticecorporatetransactionsprofessionalservices
Google AnalyticsGoogle Tag ManagerjQuery (implied by cycle plugin usage)Custom CSS and JS
2025-07-07T05:33:22.269Z
sheppardmullin.com favicon

Sheppard Mullin

sheppardmullin.com

74
OtherUnited StateslargeMEDIUM

Sheppard Mullin is a prominent AmLaw 100 law firm with a broad international presence across the United States, Europe, and Asia. The firm offers a comprehensive range of legal services spanning numerous practice areas including corporate law, litigation, intellectual property, privacy and cybersecurity, and more. Their website reflects a mature digital presence with professional branding, clear navigation, and extensive content tailored to corporate clients and legal professionals. The firm positions itself as a leader in the legal industry with recognized awards and a strong market reputation. From a technical perspective, the website employs modern web technologies including Google Tag Manager, Adobe DTM, and various analytics and marketing pixels. The site is mobile-optimized and includes accessibility features such as the UserWay widget, indicating a commitment to compliance and user inclusivity. Performance is moderate with good SEO and accessibility standards met. Security-wise, the site enforces HTTPS and uses several best practices, though it lacks explicit security headers and a public security policy or vulnerability disclosure page. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong with clear privacy and cookie policies and consent mechanisms in place. Overall, the website presents a low risk profile with a high degree of professionalism and trustworthiness. The absence of WHOIS data is a notable anomaly but does not detract significantly from the site's legitimacy given the comprehensive and consistent business information presented. Strategic recommendations include enhancing security headers, publishing a security policy, and adding a vulnerability disclosure mechanism to further strengthen trust and security posture.

70
68
47
70
67
85
100
lawfirmlegalservicesamlaw100privacypolicycookiepolicy+2 more
JavaScriptGoogle Tag ManagerSiteimprove AnalyticsLinkedIn Insight Tag+3
2025-07-07T05:32:42.180Z
schwabe.com favicon

Schwabe

schwabe.com

63
OtherUnited StateslargeMEDIUM

Schwabe is a well-established regional law firm with over 130 years of history, focusing on providing tailored legal services across various industries in the Northwest United States. Their website reflects a professional and comprehensive presentation of their services, emphasizing industry-specific expertise and client commitment. The firm targets businesses and legal professionals seeking specialized counsel in sectors such as manufacturing, healthcare, natural resources, maritime, real estate, and technology. The business model centers on delivering legal solutions aligned with regional and industry needs, positioning Schwabe as a trusted legal partner in their market. Technically, the website is built on WordPress and incorporates modern web technologies including Google Fonts, Google Tag Manager, and New Relic for performance monitoring. The site is mobile-optimized, accessible, and SEO-friendly, with a fast to moderate performance profile. Security measures include HTTPS enforcement, use of Google reCAPTCHA on forms, and a cookie consent mechanism, indicating a mature digital infrastructure. From a security perspective, the site demonstrates good practices such as encrypted connections and bot protection. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. The absence of WHOIS data reduces transparency but does not detract significantly from the site's legitimacy given the professional presentation and consistent branding. Overall, Schwabe's website presents a low-risk profile with strong business credibility and a solid technical foundation. Strategic recommendations include enhancing security headers, publishing security policies, and improving WHOIS transparency to further strengthen trust and compliance.

25
53
2
70
95
80
100
lawfirmlegalservicesprofessionalservicesregionalbusinessindustryfocused
WordPressGoogle FontsGoogle Tag ManagerGoogle reCAPTCHA+2
2025-07-07T05:32:32.166Z
wwhgd.com favicon

Weinberg Wheeler

wwhgd.com

67
OtherUnited StatesmediumMEDIUM

Weinberg, Wheeler, Hudgins, Gunn & Dial, LLC is a national litigation law firm specializing in complex, high-exposure cases, particularly in construction law and catastrophic legal disputes. The firm positions itself as a bold and innovative advocate with extensive trial and arbitration experience across multiple states. Their website reflects a professional and polished digital presence, targeting corporate clients, insurance carriers, and legal professionals seeking expert litigation services. The firm emphasizes its strategic approach and proven track record through client testimonials and detailed service descriptions. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, WebP images for optimized media delivery, and HTML5 video content. The site is mobile-optimized with good accessibility and SEO practices. However, no CMS or hosting provider details are explicitly identified. Performance is moderate with room for improvement in security header implementation. From a security perspective, the site uses HTTPS and has a cookie consent mechanism aligned with privacy regulations, including GDPR compliance. However, no explicit security policies or incident response contacts are published, and security headers are not detected, which could be improved to enhance protection and trust. The absence of WHOIS data for the domain is a notable concern, as it reduces transparency and trustworthiness from a domain registration standpoint. Overall, the website is professional and trustworthy in content and design but would benefit from improved domain registration transparency and enhanced security practices to strengthen its risk posture and compliance stance.

55
68
17
70
72
80
100
lawfirmlitigationconstructionlawtrialadvocacylegalservices+3 more
Google AnalyticsGoogle Tag ManagerSlick CarouselCustom JavaScript+2
2025-07-07T05:32:22.151Z