Skip to main content

Manufacturing security reports

Browse 6,694 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

155884
Websites
130
Industries
113
Countries
52
Avg Score
Page 4 of 134|Showing 151-200 of 6694
linkcableassemblies.co.uk favicon

Link Cable Assemblies Ltd

linkcableassemblies.co.uk

50
ManufacturingUnited KingdomsmallMEDIUM

Link Cable Assemblies Ltd is a UK-based manufacturer specializing in bespoke cable assemblies, control panels, and associated electronic components serving a variety of industries. The company emphasizes quality, demonstrated by IPC and J standard soldering accreditations and participation in SC21, positioning itself as a trusted supplier in the manufacturing sector. Their website showcases detailed case studies and highlights key services such as cable assemblies, box build, and design & drawings, targeting businesses requiring custom electronic interconnect solutions. Technically, the website is built on WordPress using Elementor and Yoast SEO, hosted likely on WPEngine. It features modern web technologies, is mobile-optimized, and includes Google Analytics for user tracking. The site performs moderately well with good SEO and accessibility basics but lacks some advanced security headers and privacy compliance documentation. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data or vulnerable libraries. However, it lacks explicit privacy and cookie policies, security headers, and incident response contacts, which are important for GDPR compliance and overall security posture. The WHOIS data is unavailable due to an invalid query on the 'www' subdomain, limiting domain registration trust verification. Overall, the website is professional and trustworthy from a business and content perspective but would benefit from enhanced privacy compliance, security headers, and clearer incident response mechanisms to improve its security posture and regulatory adherence.

37
65
60
100
2
20
35
manufacturingcableassembliesbespokecablesqualityuk+1 more
WordPressElementorYoast SEOjQuery+1
2026-07-15T07:22:51.425Z
wgbaird.com favicon

W&G Baird Commercial Printers UK, Ireland

wgbaird.com

55
ManufacturingUnited KingdommediumMEDIUM

W&G Baird Commercial Printers is a well-established printing company based in Northern Ireland, serving businesses across the UK and Ireland. With over 160 years of experience, they specialize in litho, digital, large format, and book printing services. The company holds reputable certifications including FSC®, ISO 9001, and ISO 14001, underscoring their commitment to quality and sustainability. Their website reflects a professional and consistent brand image, targeting business clients seeking high-quality commercial printing solutions. Technically, the website is built on WordPress using modern plugins such as Elementor and Slider Revolution, hosted likely on Hostinger. It employs Google Tag Manager for analytics and CookieYes for cookie consent management, indicating a moderate level of digital maturity. The site is mobile-optimized with good SEO practices but could improve accessibility features. From a security perspective, the site uses HTTPS and has implemented cookie consent mechanisms. However, explicit security headers are not fully evident, and no privacy policy or incident response information is published, which are areas for improvement. The absence of WHOIS data for the domain raises concerns about domain registration transparency, although the website content and business information appear legitimate and professional. Overall, the website presents a low risk but would benefit from enhanced transparency in domain registration, publication of privacy and security policies, and strengthening of security headers to improve trust and compliance.

47
80
20
85
30
83
17
commercialprintinglithoprintdigitalprintbookprintingfsccertified+4 more
WordPressElementorSlider RevolutionGoogle Tag Manager+1
2026-07-15T07:22:34.634Z
filon.co.uk favicon

Filon Products Ltd

filon.co.uk

60
ManufacturingUnited KingdommediumMEDIUM

Filon Products Ltd is a well-established UK manufacturer specializing in GRP (Glass Reinforced Polyester) products for roofing, cladding, and construction industries. Founded in 1957, the company holds a leading market position with a broad product portfolio including rooflights, sheets, valley troughs, and refurbishment solutions. Their business model focuses on manufacturing and supplying durable, innovative GRP products to construction professionals and specifiers. The website reflects a professional and consistent brand image with comprehensive product information and strong trust indicators such as certifications and social media presence. Technically, the website is built on WordPress with modern technologies including Tailwind CSS, Google Tag Manager, Microsoft Clarity, and CookieYes for consent management. The site is fast, mobile-optimized, accessible, and SEO-friendly, demonstrating a mature digital infrastructure. Privacy compliance is well addressed with clear privacy and cookie policies and user consent mechanisms. From a security perspective, the site enforces HTTPS and uses cookie consent management effectively. However, there is room for improvement by implementing additional security headers and publishing explicit security policies or incident response information. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website and business present a low-risk profile with strong credibility and compliance. The WHOIS lookup failure is due to querying a subdomain rather than the registered domain and does not detract from the legitimacy of the business. Strategic recommendations include enhancing security headers, publishing a security policy, and adding vulnerability disclosure mechanisms to further strengthen trust and security posture.

60
85
40
42
95
70
2
grpproductsroofingsolutionsmanufacturingconstructionprivacy+4 more
WordPressTailwind CSSGoogle Tag ManagerCookieYes Consent Management+2

Partner Domains:

profiles.filon.co.uk
partner
oneblackbear.com
partner
2026-07-15T07:18:49.783Z
finally.agency favicon

FINALLY Agency

finally.agency

67
ManufacturingUnited KingdommediumMEDIUM

FINALLY Agency is a specialized award-winning B2B marketing agency based in Canterbury, Kent, UK, focusing on the engineering, manufacturing, medical, and technology sectors. The company offers a comprehensive suite of marketing services including creative B2B marketing, digital transformation, marketing automation, integrated campaigns, and CRM consulting. Their market position is strong within their niche, supported by client testimonials and case studies that demonstrate credibility and expertise. Technically, the website is built on HubSpot CMS and leverages modern JavaScript libraries such as Typed.js, along with Google Analytics 4 and Google Tag Manager for analytics and tracking. The site is well-optimized for mobile devices, has good SEO practices, and uses secure HTTPS connections. Privacy and cookie policies are implemented with consent mechanisms, reflecting good compliance with GDPR. From a security perspective, the site enforces HTTPS and uses secure forms with CAPTCHA, but lacks explicit published security policies or incident response information. No critical vulnerabilities or exposed sensitive data were detected. WHOIS data is unavailable due to privacy or query failure, but the domain appears legitimate and consistent with the business claims. Overall, the website presents a professional, trustworthy, and secure digital presence suitable for its B2B audience. Strategic recommendations include enhancing security headers, publishing security and incident response policies, and implementing a vulnerability disclosure program to further strengthen trust and compliance.

52
82
80
100
2
50
83
b2bmarketingdigitaltransformationengineeringmanufacturingmarketingagency+1 more
HubSpot CMSTyped.jsGoogle Analytics 4Google Tag Manager+2
2026-07-15T07:18:01.539Z
scanlite.co.uk favicon

Scanlite Visual Communications Ltd.

scanlite.co.uk

52
ManufacturingUnited KingdommediumMEDIUM

Scanlite Visual Communications Ltd. is a UK-based company specializing in the design, manufacture, and installation of bespoke LED and digital signage solutions. With over 40 years of industry experience and more than 40,000 installations worldwide, Scanlite serves a diverse range of sectors including retail, hospitality, healthcare, education, and transportation. Their product portfolio includes indoor and outdoor video displays, video walls, pharmacy crosses, financial tickers, and more, complemented by repair, installation, and rental services. The company positions itself as a trusted expert in digital LED signage with a strong market presence in the UK and internationally. Technically, the website is built on WordPress 7.0.1 with modern JavaScript libraries such as jQuery and Slick Carousel, and employs SEO best practices via the Yoast SEO plugin. It integrates Google Tag Manager, Matomo Analytics, and Demandbase for marketing and analytics purposes. The site is mobile-optimized and features a professional design with clear navigation and structured content. Security measures include HTTPS enforcement and Google reCAPTCHA on forms, although some security headers could be improved. From a security perspective, the website demonstrates a good baseline posture with encrypted communications and spam prevention on forms. However, the absence of explicit security headers and a formal security policy or incident response information suggests room for enhancement. Privacy compliance is supported by a comprehensive privacy policy and cookie consent mechanism, indicating adherence to GDPR requirements. Overall, Scanlite's website reflects a mature, professional business with solid technical infrastructure and a good security baseline. Strategic improvements in security headers and transparency around security policies would further strengthen their posture. The site is safe for general audiences, with no adult or questionable content detected.

57
70
85
20
15
17
68
ledsignagedigitalsignageleddisplaysdigitaldisplaysbusinesssignage+5 more
WordPress 7.0.1jQuery 3.7.1Slick CarouselYoast SEO plugin+6
2026-07-15T07:14:43.168Z
weber.co.uk favicon

Weber Packaging Solutions UK

weber.co.uk

49
ManufacturingUnited KingdommediumHIGH

Weber Packaging Solutions UK is a well-established company specializing in labelling and coding solutions, serving a diverse range of industries including manufacturing, healthcare, logistics, and retail. The company offers a comprehensive portfolio of products such as label printers, applicators, inkjet coders, RFID systems, and related software and services. Their market position is strong, supported by nearly a century of industry experience and a broad client base including major brands and public sector entities. Technically, the website is built on a modern WordPress platform with a robust tech stack including Bootstrap, WooCommerce, and various plugins for SEO, social media integration, and cookie compliance. The site demonstrates good mobile optimization, SEO practices, and user experience, although some accessibility features could be enhanced. From a security perspective, the site enforces HTTPS and employs cookie consent mechanisms, with indications of security plugins like Wordfence. However, explicit security headers are not detected, and there is no public incident response or security policy page. No vulnerabilities or exposed sensitive data were found in the analysis. Overall, the website presents a professional and trustworthy digital presence with strong business credibility. The lack of WHOIS data for the exact subdomain is explained by domain naming rules, and the main domain is presumably registered and legitimate. Strategic improvements in security headers and incident response transparency would further strengthen the security posture.

47
65
60
20
17
85
15
labellingpackaginglabelprinterindustrialmanufacturing+4 more
WordPressYoast SEOjQueryBootstrap+8

Partner Domains:

www.epson.com
partner
www.datamax-oneil.com
partner

+2 more partners

2026-07-14T07:27:17.311Z
quality-films.co.uk favicon

Trioworld

quality-films.co.uk

71
ManufacturingUnited KingdomlargeMEDIUM

Trioworld is a global manufacturer and supplier specializing in high-performance polyethylene film packaging solutions, with a strong emphasis on sustainability and circular economy principles. The company targets business customers in the packaging and manufacturing sectors, positioning itself as a leading global supplier with a comprehensive portfolio. The website reflects a professional and consistent brand image, supported by modern web technologies and a clear focus on B2B services. Technically, the website is built using modern JavaScript frameworks such as Vue.js and integrates multiple analytics and marketing tools including Google Tag Manager, Bing Ads, and Cookiebot for consent management. The site is mobile-optimized and demonstrates good SEO practices, although some accessibility features could be improved. Performance is moderate with room for optimization. From a security perspective, the site enforces HTTPS and implements a robust cookie consent mechanism with granular user controls. However, explicit security headers are not detected, and there is no visible security policy or incident response contact information. The absence of WHOIS data and domain registration inconsistencies raise some concerns about domain legitimacy, although the website content and branding appear trustworthy. Overall, the website presents a solid digital presence for Trioworld, but improvements in transparency regarding security policies, contact information, and domain registration details are recommended to enhance trust and compliance.

70
100
57
80
85
83
17
packagingpolyethylenefilmmanufacturinghigh-performancefilmcirculareconomy+3 more
JavaScriptGoogle Tag ManagerCookiebotBing Ads+1

Partner Domains:

portal.trioworld.com
partner
trioworld.com
partner

+3 more partners

2026-07-14T07:22:25.585Z
solartronmetrology.com favicon

Solartron Metrology

solartronmetrology.com

70
ManufacturingUnited StatesmediumMEDIUM

Solartron Metrology is a specialized manufacturer of precision displacement measurement sensors and related metrology equipment, operating as a subsidiary of AMETEK, Inc. The company serves industrial and manufacturing sectors with a focus on high-accuracy LVDT sensors, non-contact measurement devices, and digital measurement networks. Their market position is that of a niche player with a strong technical product portfolio and international presence through regional websites. Technically, the website is built on ASP.NET with modern JavaScript libraries and integrates Google Analytics and OneTrust for tracking and privacy compliance. The site is mobile optimized and provides a professional user experience with clear navigation and comprehensive content. Security-wise, the site enforces HTTPS and uses cookie consent mechanisms but lacks some advanced security headers and a public vulnerability disclosure policy. The WHOIS data for the domain is missing, which is unusual and may indicate privacy protection or registration issues, but the association with AMETEK supports legitimacy. Overall, the website is professional, secure, and compliant with privacy regulations, though improvements in security headers and transparency could enhance trust further.

74
85
100
70
60
17
73
displacementsensorslvdtmeasurementmetrologyindustrial+2 more
JavaScriptjQuery 3.7.1Google Tag ManagerGoogle Analytics+2

Partner Domains:

ametek.com
parent
2026-07-14T07:22:09.590Z
darkegroup.co.uk favicon

Darke Group Ltd

darkegroup.co.uk

42
ManufacturingUnited KingdommediumHIGH

Darke Group Ltd is a UK-based company specializing in bespoke steel fabrications and complex architectural metalwork, serving architects, designers, contractors, and developers. The company offers a comprehensive range of services including structural steelwork, architectural metalwork, steel boats, staircases, balconies, handrails, and balustrades. Established in 2009, Darke Group holds a strong market position as a leading UK provider in its sector, supported by accreditations and client testimonials. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress using common plugins such as Slider Revolution and Contact Form 7. It employs modern JavaScript libraries like jQuery and integrates Google Analytics and Tag Manager for user tracking. Hosting is provided by Fasthosts Internet Ltd, a reputable registrar. The site demonstrates moderate performance and good mobile optimization but lacks some advanced accessibility features. From a security perspective, the site uses HTTPS with good SSL configuration but lacks visible security headers and an incident response contact. There is no cookie consent mechanism despite having a cookie policy, which may affect GDPR compliance. No vulnerabilities or exposed sensitive data were detected in the HTML content. Overall, the security posture is adequate but could be improved with additional headers and formal incident response procedures. The overall risk assessment indicates a trustworthy and professional business website with minor compliance and security gaps. Strategic recommendations include implementing security headers, adding a cookie consent mechanism, establishing an incident response contact, and maintaining up-to-date software to enhance security and compliance posture.

65
55
-
52
68
15
2
architecturalmetalworksteelfabricationconstructionbalconiesstaircases+3 more
jQuerySlider RevolutionContact Form 7PrettyPhoto+2
2026-07-14T07:16:26.179Z
indpaintandpowder.co.uk favicon

Industrial Paint & Powder Ltd

indpaintandpowder.co.uk

55
ManufacturingUnited KingdomsmallMEDIUM

Industrial Paint & Powder Ltd is a well-established supplier of industrial coatings, including wet paint systems, powder coatings, colour matching, and technical support services primarily serving businesses across Scotland. With over 60 years of industry experience and ISO 9001 certification, the company positions itself as a trusted partner in the manufacturing and finishing sectors. Their website reflects a professional and consistent brand image, targeting industrial and commercial clients seeking reliable coating solutions. The technical infrastructure is modern and leverages Webflow CMS, Google Fonts, and jQuery, hosted on a reputable platform with HTTPS enabled. The site is mobile-optimized and demonstrates good SEO and accessibility practices, although performance is moderate. There are no detected tracking or advertising scripts, indicating a focus on straightforward business communication rather than marketing automation. From a security perspective, the website benefits from HTTPS and absence of exposed sensitive data or vulnerable libraries. However, it lacks security headers and published security policies or incident response contacts, which are areas for improvement. Privacy compliance is weak due to the absence of privacy and cookie policies and consent mechanisms, which could expose the company to regulatory risks. Overall, the website is credible and trustworthy with strong business credibility and technical implementation but requires enhancements in privacy compliance and security best practices to reduce risk and improve user trust.

70
49
60
100
35
30
17
industrialcoatingspowdercoatingswetpaintsystemscolourmatchingtechnicalsupport+3 more
WebflowjQuery 3.5.1Google Fonts (Onest, Roboto)JSON-LD structured data
2026-07-14T07:14:12.597Z
inspectionsystemservices.co.uk favicon

Inspection System Services

inspectionsystemservices.co.uk

46
ManufacturingUnited KingdomsmallHIGH

Inspection System Services (ISS) is a UK-based specialist company providing metal detection and check weighing inspection services primarily to the food production industry. Established in 1996, ISS offers a range of services including maintenance contracts, consultancy, training, equipment sales, and technical support. The company positions itself as a trusted partner to major UK food producers and retailers, emphasizing safety and compliance. The website reflects a professional business presence with clear service offerings and client logos, targeting UK food manufacturers and retailers. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and uses Google Analytics and Google Tag Manager for tracking. The site is mobile-optimized and has good SEO practices but lacks some advanced accessibility features. Hosting is provided by 123-Reg Limited, consistent with the UK location. Performance is moderate with standard modern web technologies. From a security perspective, the site uses HTTPS and does not expose sensitive data in the HTML. However, it lacks important security headers like Content-Security-Policy and HSTS, and no privacy or cookie policies are published, which is a compliance risk under GDPR. No incident response or vulnerability disclosure information is available. The site uses tracking technologies but does not provide explicit user consent mechanisms. Overall, the website is professional and trustworthy but requires improvements in privacy compliance and security hardening to reduce risk and enhance user trust. Adding privacy and cookie policies, security headers, and incident response information would strengthen the security posture and regulatory compliance.

70
57
60
40
53
15
2
inspectionmetaldetectioncheckweighingfoodproductionconsultancy+3 more
WordPress 7.0.1Yoast SEO pluginjQuery 2.2.0Google Tag Manager+5
2026-07-13T07:27:00.216Z
servosteel.com favicon

Steelstrip Services Ltd t/a Servosteel

servosteel.com

58
ManufacturingUnited KingdommediumMEDIUM

Servosteel is a UK-based steel service centre specializing in toll processing, coil pickling, slitting, decoiling, laser services, and steel sales. Positioned as the UK's leading independent steel processor, the company offers a comprehensive suite of steel processing and sales services supported by an online marketplace and customer portal. The website reflects a professional business with ISO 9001 and ISO 14001 certifications, indicating a commitment to quality and environmental standards. Technically, the site is built on ASP.NET Web Forms with legacy jQuery and includes interactive features such as sliders and cookie consent mechanisms. While the site is accessible and well-structured, some technical aspects like outdated libraries and missing security headers suggest room for improvement. The security posture is moderate, with no critical vulnerabilities detected but lacking advanced security headers and incident response information. The absence of WHOIS data for the domain raises concerns about domain transparency, although the website content and certifications support business legitimacy. Overall, the site scores well in content quality and business credibility but should address technical and security enhancements to improve trust and compliance.

65
100
80
57
15
73
2
steelprocessingcoilpicklingslittingdecoiling+5 more
ASP.NET Web FormsjQuery 1.7.1Nivo SliderThickbox+1
2026-07-13T07:25:19.901Z
moyola.com favicon

Moyola Precision Engineering

moyola.com

52
ManufacturingUnited KingdommediumMEDIUM

Moyola Precision Engineering is an established UK-based company founded in 1976, specializing in integrated machining and assembly solutions primarily for the Civil Aerospace, Defence, Space, and Industrial sectors. The company holds a prestigious ADS SC21 Gold award, highlighting its operational excellence and innovation. Their business model focuses on B2B manufacturing services, offering a range of expertise including CADCAM, quality inspection, milling, and titanium machining. The website reflects a professional and consistent brand image targeting industrial clients globally. Technically, the website is built on WordPress using popular plugins such as Yoast SEO, WPBakery Page Builder, and Slider Revolution. It employs Google Analytics and a cookie consent mechanism compliant with GDPR, indicating a mature digital infrastructure. The site is mobile-optimized with good SEO practices, though accessibility features are basic. Performance is moderate, with room for optimization. From a security perspective, the site uses HTTPS with no visible exposed sensitive data or vulnerable libraries. However, it lacks explicit security headers and dedicated security or incident response pages. The cookie consent implementation is robust, but there is no security.txt or vulnerability disclosure policy. The WHOIS data is missing, which raises concerns about domain registration transparency, though the website content and contact details suggest legitimacy. Overall, Moyola Precision Engineering presents a credible and professional online presence with solid privacy compliance. The main risk lies in the lack of WHOIS transparency and some missing security best practices. Strategic improvements in security headers, incident response visibility, and domain registration clarity are recommended to enhance trust and security posture.

70
20
85
47
80
17
20
manufacturingprecisionengineeringaerospacedefenseindustrial+3 more
WordPressYoast SEOWPBakery Page BuilderSlider Revolution+3
2026-07-13T07:20:25.163Z
kestevencomponents.co.uk favicon

Kesteven Components Ltd

kestevencomponents.co.uk

63
ManufacturingUnited KingdomsmallMEDIUM

Kesteven Components Ltd is a small UK-based manufacturing business specializing in supplying hardwood and softwood edge-laminated panels and timber products primarily to the furniture trade. Established in 1996 and located in Sleaford, Lincolnshire, the company offers a range of products including worktops, tabletops, kitchen doors, and CNC/laser engraving services. Their market position is that of a trusted regional supplier with a focus on B2B relationships within the UK Midlands furniture manufacturing community. The website reflects a professional and consistent brand presence with good content quality and clear navigation tailored to their target audience of furniture manufacturers and related businesses. Technically, the website is built on a proprietary Website Editor platform hosted likely by 1&1 IONOS with modern JavaScript libraries such as jQuery and skrollr for animations. The site uses HTTPS with good SSL configuration and content delivery via Cloudfront CDN, ensuring moderate performance and good mobile optimization. However, accessibility features are basic, and SEO is adequately addressed through meta tags and structured content. From a security perspective, the site enforces HTTPS and includes a cookie consent banner, but lacks important security headers and explicit privacy or terms of service pages. No WHOIS data is available due to domain naming errors, which raises concerns about domain registration legitimacy despite the professional website content. No forms or email contacts are present on the homepage, limiting direct data collection points. Analytics are implemented via Snowplow, indicating moderate user tracking. Overall, the website presents a trustworthy and professional front for a small manufacturing supplier but would benefit from improved transparency in privacy and security policies, domain registration clarity, and enhanced security headers to strengthen its security posture and compliance. The lack of WHOIS data is a notable r…

69
70
85
100
50
53
2
hardwoodsoftwoodpanelsedge-laminatedcnc+5 more
jQuery 2.2.4skrollrCloudfront CDNWebsite Editor platform (1AND1_EU_PROD)+3
2026-07-13T07:15:41.166Z
acmeseals.com favicon

Acme Seals Group

acmeseals.com

48
ManufacturingMalaysiamediumHIGH

Acme Seals Group is a well-established manufacturer and supplier of tamper-evident security seals with a history dating back to 1884. The company operates globally with a significant presence in Malaysia and the UK, offering a wide range of customizable security seals including plastic, metal, barrier, meter, and padlock seals. Their market position is strong, supported by ISO-9001:2015 certification and a reputation for quality and reliability across multiple industries such as maritime, aviation, cargo, and retail. Technically, the website is built on WordPress using modern technologies like jQuery, Bootstrap, and Google Analytics for tracking. The site is mobile-optimized and provides a good user experience with clear navigation and professional design. However, there is room for improvement in accessibility and performance optimization. From a security perspective, the site uses HTTPS and implements basic anti-spam measures in forms but lacks advanced security headers and explicit security policies. There is no visible incident response or vulnerability disclosure information, which could be enhanced to improve trust and compliance. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. Overall, the website and business demonstrate a solid and trustworthy presence with moderate technical and security maturity. Strategic improvements in security headers, privacy compliance, and incident response transparency would further strengthen their posture and customer confidence.

47
70
80
20
15
17
53
securitysealsmanufacturingtamper-evidentmalaysiaiso-9001+1 more
jQueryGoogle AnalyticsGoogle Tag ManagerGravity Forms+1
2026-07-13T07:13:50.917Z
granorte.pt favicon

GRANORTE - Revestimentos de Cortiça, Lda.

granorte.pt

39
ManufacturingPortugalmediumHIGH

GRANORTE - Revestimentos de Cortiça, Lda. is a well-established Portuguese family-owned manufacturing company founded in 1972, specializing in cork coatings and flooring products. The company holds a strong market position as one of the leading cork manufacturers, offering a wide range of cork flooring and wall tile products, including custom design solutions and a room floor simulator tool. The website is professionally designed with multilingual support, targeting both B2B and end customers interested in sustainable cork products. Technically, the site uses modern web technologies such as Google Analytics, Facebook Pixel, and Google reCAPTCHA, and is built on the AZCMS by LOBA platform. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. Security posture is solid with HTTPS enforced and bot protection on forms, though there is room for improvement in security headers and explicit incident response policies. Privacy compliance is partially met with a comprehensive privacy policy and terms of service, but lacks a visible cookie consent mechanism. Overall, the website is trustworthy and professional, reflecting the company's credibility and market standing.

62
65
55
-
20
28
2
manufacturingcorkflooringdesignsustainability+2 more
Google AnalyticsFacebook PixelGoogle reCAPTCHAFlickity Carousel+2

Partner Domains:

www.loba.pt
partner
www.trendcollectionbygranorte.com
related

+1 more partners

2026-07-13T07:11:49.905Z
camberleyrubber.com favicon

Camberley Rubber Mouldings Ltd

camberleyrubber.com

45
ManufacturingUnited KingdommediumHIGH

Camberley Rubber Mouldings Ltd is a well-established UK-based specialist manufacturer of bespoke rubber mouldings and custom rubber products, serving industrial, commercial, and military sectors worldwide. Founded in 1969 and part of the Camberley Group PLC, the company offers a comprehensive range of rubber manufacturing services including injection moulding, bonding, compression, and transfer moulding, supported by advanced tooling and product design advice. The website reflects a mature business with a strong market position and a broad customer base. Technically, the website is built on WordPress and leverages modern technologies such as Google Analytics and Snitcher for analytics and tracking. It is hosted on a performant platform (likely Pressidium) with good mobile optimization and SEO practices. The site includes a cookie consent mechanism and privacy policy indicating GDPR compliance, though explicit security headers are not evident. Security posture is solid with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. However, the absence of WHOIS registration data and lack of published security policies or incident response contacts represent areas for improvement. Overall, the site is professional, trustworthy, and well-maintained but would benefit from enhanced transparency in security and domain registration details. Strategically, the company should focus on improving security disclosures and ensuring domain registration transparency to bolster trust and compliance, while continuing to leverage its strong brand and technical capabilities to maintain market leadership.

75
55
20
47
50
15
17
rubbermouldingmanufacturingcustomrubberproductsindustrialtechnicalmanufacturing+1 more
Google AnalyticsSnitcherjQueryWordPress+1

Partner Domains:

www.camberleygroupplc.com
parent
www.camlocksafety.com
partner

+1 more partners

2026-07-12T07:26:15.485Z
precision-refrigeration.co.uk favicon

Precision Refrigeration

precision-refrigeration.co.uk

65
ManufacturingUnited KingdommediumMEDIUM

Precision Refrigeration is a UK-based manufacturer specializing in professional refrigeration equipment for commercial kitchens. Their product range includes cabinets, counters, blast chillers, and specialized refrigeration units, supported by a dedicated spares webshop. The company targets professional kitchens and hospitality sectors, emphasizing robust and reliable products with strong customer service. Technically, the website is built on the Squarespace platform, leveraging modern web technologies and analytics tools such as Google Analytics and Tag Manager. The site is mobile-optimized and presents a professional design with clear navigation. Security-wise, the site enforces HTTPS and uses reCAPTCHA for forms, but lacks explicit privacy policies and security disclosures, which are areas for improvement. The absence of WHOIS data for the domain raises some concerns about domain registration transparency, although the website content and structure suggest a legitimate business. Overall, the site scores well on content quality and technical implementation but should enhance privacy compliance and domain registration transparency to improve trust and security posture.

54
100
80
70
80
17
50
refrigerationprofessionalkitchenmanufacturingcommercialrefrigerationsquarespace
Squarespace CMSGoogle AnalyticsGoogle Tag ManagerreCAPTCHA

Partner Domains:

precision-spares.com
partner
precision-refrigeration.com.cn
related

+2 more partners

2026-07-12T07:22:41.346Z
tubeandsteel.com favicon

Tube and Steel Supplies Ltd

tubeandsteel.com

63
ManufacturingUnited KingdommediumMEDIUM

Tube and Steel Supplies Ltd is a medium-sized, privately owned steel stockholder and processor based in Newport, South Wales, established in 1999. The company specializes in supplying quality steel tubes, fittings, flanges, and related products, servicing both UK and international markets. Their key services include cutting, galvanising, threading, welding, fabrication, shot blasting, coating, and international export, positioning them as a leading distributor in their sector. The website reflects a professional business presence with clear contact information and service descriptions. Technically, the website is built on the MultiScreenSite CMS platform, utilizing modern web technologies such as jQuery, Slick Slider, Google Tag Manager, and Snowplow Analytics. It supports progressive web app features via service workers and is hosted on a reliable CDN infrastructure. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. From a security perspective, the site enforces HTTPS and uses secure forms with opt-in consent. However, explicit security headers are not detected, and there is no visible incident response or vulnerability disclosure information. The absence of WHOIS data for the domain raises concerns about domain registration legitimacy, although the website content and business information appear trustworthy and professional. Overall, the site presents a solid business and technical foundation but would benefit from enhanced security practices and clearer domain registration transparency to improve trust and compliance.

59
55
100
75
53
17
70
steelstockholderprocessorpipefittings+7 more
jQuery 3.7.0Slick SliderGoogle Tag ManagerSnowplow Analytics+4
2026-07-12T07:22:03.793Z
2

2D Engineering Ltd

2d-engineering.com

52
ManufacturingUnited KingdomsmallMEDIUM

2D Engineering Ltd is a small, independent UK-based manufacturing company specializing in precision CNC machining services including turning, grinding, and milling. Founded in 1992 and located near Ashford, Kent, the company serves a diverse range of engineering sectors such as aerospace, defense, scientific, electronics, automotive, petrochemical, and industrial tooling. Their business model focuses on medium to low volume manufacturing with a strong emphasis on customer collaboration and problem-solving. The website reflects a professional and consistent brand image with clear contact information and trust indicators such as UKAS certification and company registration details. Technically, the website employs a legacy jQuery version alongside modern tools like Google Analytics and CookieConsent for GDPR compliance. The site is mobile optimized with good SEO practices and a moderate performance profile. However, the absence of security headers and use of outdated libraries present moderate technical risks. The site uses HTTPS, ensuring secure communications. From a security perspective, the website demonstrates basic best practices including cookie consent and encrypted connections but lacks advanced security headers and incident response disclosures. The missing WHOIS registration data is a significant concern, potentially indicating domain registration issues that could affect trustworthiness. No forms or social media links are present, limiting attack surface but also reducing engagement channels. Overall, the website is professional and trustworthy from a business perspective but requires improvements in security posture and domain registration transparency. Strategic recommendations include implementing security headers, updating JavaScript libraries, publishing security policies, and verifying domain registration status to enhance credibility and compliance.

-
70
70
52
35
17
95
engineeringcncmanufacturingprecisionmachiningkent+3 more
jQuery 2.2.4ModernizrFontAwesomeGoogle Analytics+2
2026-07-12T07:21:10.022Z
V

Venturi Jet Pumps Ltd

venturipumps.com

50
ManufacturingUnited KingdomsmallMEDIUM

Venturi Jet Pumps Ltd is a specialized manufacturer of venturi process equipment with over 20 years of experience serving diverse industrial sectors including food, wastewater treatment, power, chemical, petrochemical, and aerospace. Their product portfolio includes eductors, syphons, heaters, exhausters, compressors, thermocompressors, desuperheaters, vacuum ejectors, and gas scrubbers, catering to global industrial clients. The company emphasizes custom design solutions to optimize operational efficiency. Technically, the website employs legacy technologies such as jQuery 1.8.3 and common UI libraries like Owl Carousel and Lightcase. The site is moderately optimized for performance and mobile responsiveness but lacks modern security headers and updated libraries. No CMS or hosting provider details are evident. SEO and accessibility are basic but adequate for the business domain. From a security perspective, the site uses HTTPS as implied by canonical links but lacks explicit security headers and privacy policies. The outdated jQuery version presents a potential vulnerability. No forms collect sensitive data, reducing immediate risk exposure. WHOIS data is missing or inaccessible, which raises concerns about domain registration legitimacy despite professional website content and clear contact information. Overall, the website presents a professional industrial business front with good content quality and business credibility but requires improvements in privacy compliance, security best practices, and domain registration transparency to enhance trust and reduce risk.

55
60
62
100
15
35
2
industrialmanufacturingventuripumpsprocessequipmentengineering
jQuery 1.8.3jQuery UIOwl CarouselLightcase+2
2026-07-12T07:20:16.175Z
vola.com favicon

VOLA

vola.com

61
ManufacturingDenmarkmediumMEDIUM

VOLA is a Danish manufacturing company specializing in taps and accessories characterized by timeless Scandinavian design and exceptional craftsmanship since 1968. The company positions itself as a premium brand with a strong heritage, targeting architects, designers, and discerning consumers worldwide. Their business model emphasizes made-to-order production, customization, and a modular product system, supported by a global dealer and specialist network. Technically, the website employs modern web technologies including AngularJS, Google Tag Manager, and Cookiebot for consent management, hosted likely behind Cloudflare, ensuring good performance and mobile optimization. Security posture is strong with HTTPS enforcement, CSRF protection, and cookie consent mechanisms, though explicit security policies and incident response contacts are not publicly available. Privacy compliance is well addressed with a comprehensive GDPR-aligned privacy policy and cookie consent banner. The absence of WHOIS data for the domain limits full trust verification, but the website's professional presentation and external social media presence support legitimacy. Overall, the site demonstrates a mature digital presence with room for improvement in transparency of security and contact information.

65
27
100
70
95
17
35
scandinaviandesigntapsaccessoriesdanishcraftsmanshipprivacypolicy+4 more
AngularJS (ng-app, ng-scope)Google Tag ManagerCookiebot for consent managementSwiper.js for sliders+3
2026-07-12T07:18:54.947Z
A

A Wardle & Co (Casters) Ltd.

awardle.co.uk

57
ManufacturingUnited KingdomsmallMEDIUM

A Wardle & Co (Casters) Ltd. is an independent manufacturer specializing in lost wax casting, located in the Birmingham Jewellery Quarter, UK. The company targets jewellery manufacturers and designers, offering specialized manufacturing services. The website reflects a professional and consistent brand image with clear contact information and a user-friendly interface. However, the WHOIS data for the queried domain www.awardle.co.uk is unavailable due to domain naming rules violations, indicating the actual domain in use is likely awardle.co.uk, which aligns with the company's email and contact details. Technically, the website employs modern JavaScript libraries such as Barba.js and AOS for smooth page transitions and animations, with a responsive design optimized for mobile devices. The site lacks visible security headers and privacy policies, which are critical for compliance and security posture. The contact form collects personal data with a GDPR opt-in checkbox but does not link to a privacy or cookie policy, representing a compliance gap. From a security perspective, the site uses HTTPS (assumed from the URL), but no explicit security headers were detected in the HTML content. There are no signs of WAF or blocking mechanisms, and no analytics or tracking scripts were found, indicating minimal user tracking. The absence of privacy and cookie policies and security headers lowers the overall security and privacy compliance scores. Overall, the website is functional, professional, and relevant to its manufacturing niche but requires improvements in security headers, privacy compliance, and WHOIS domain consistency to enhance trust and reduce risk.

69
70
100
70
30
2
50
manufacturinglostwaxcastingjewellerybirminghamindependentmanufacturer
HTML5CSS3JavaScript
2026-07-12T07:18:38.327Z