Skip to main content

United Kingdom security reports

Browse 7,121 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157367
Websites
130
Industries
113
Countries
52
Avg Score
Page 39 of 143|Showing 1901-1950 of 7121
hughescaterers.co.uk favicon

Hughes Caterers

hughescaterers.co.uk

58
HospitalityUnited KingdomsmallMEDIUM

Hughes Caterers is a well-established catering business based in Welshpool, Powys, UK, with a history dating back to 1908. The company specializes in catering for a wide range of events including weddings, private parties, and corporate functions, offering tailored menus and full event management services. Their market position is that of a trusted local catering provider with over a century of experience, targeting customers in Powys, Shropshire, and surrounding areas. The website reflects a professional and consistent brand image with clear service offerings and contact information. Technically, the website is built on a modern stack including jQuery and skrollr.js, hosted likely on multiscreensite.com infrastructure with CDN support. It uses HTTPS with a valid SSL certificate and integrates Mapbox for location display and Snowplow Analytics for user tracking. The site is mobile-optimized and has good SEO practices, though accessibility features are basic. However, the absence of privacy and cookie policies and lack of security headers indicate areas for improvement in compliance and security hardening. From a security perspective, the site benefits from HTTPS and no visible vulnerabilities or exposed sensitive data. The lack of security headers and incident response information reduces the overall security posture. The WHOIS data for the domain is unavailable due to a domain registration error indicating the domain name is invalid per Nominet UK rules, which raises concerns about domain legitimacy despite the professional website content. Overall, Hughes Caterers presents a credible and professional online presence for their catering business, but improvements in privacy compliance, security headers, and domain registration legitimacy are recommended to enhance trust and security.

100
49
45
70
35
17
70
cateringweddingseventshospitalitylocalbusiness+3 more
jQuery 3.7.0skrollr.jsMapboxGoogle Fonts+1
2026-07-10T07:21:19.617Z
swishbp.co.uk favicon

Swish Building Products

swishbp.co.uk

42
ManufacturingUnited KingdommediumHIGH

Swish Building Products is a UK-based manufacturer specializing in UPVC fascias, soffits, gutters, cladding, and window boards primarily serving social housing, newbuild, and trade construction markets. The company operates under Specialist Building Products Limited, a subsidiary of the Epwin Group, and emphasizes environmentally responsible manufacturing practices, including the use of Octyl Tin stabilizers and multiple Environmental Product Declarations (EPDs). Their website provides comprehensive product information, technical support, and installer locator services, targeting construction professionals and industry stakeholders. Technically, the website is built on the Concrete5 CMS platform, utilizing modern frontend technologies such as jQuery, Foundation CSS, and Font Awesome. The site is mobile-optimized with good navigation and SEO practices. Security measures include HTTPS enforcement and CAPTCHA on forms, though explicit security headers are not detected. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms. From a security perspective, the site shows a moderate security posture with no visible vulnerabilities or exposed sensitive data. However, the WHOIS lookup for the domain failed due to a domain naming error, which raises concerns about domain registration legitimacy. Despite this, the website content and business information align with a legitimate, established company. Overall, the site scores well on content quality, technical implementation, and business credibility but is slightly penalized for WHOIS inconsistencies and missing security headers. Strategically, Swish Building Products should focus on enhancing security headers, publishing explicit security and incident response policies, and resolving domain registration issues to strengthen trust and compliance. These improvements will support their market position and digital maturity while mitigating potential risks.

47
-
70
65
53
2
20
buildingproductsupvcfasciassoffitsgutterscladding+4 more
jQueryFoundation CSS frameworkFont AwesomeGoogle Fonts (Open Sans)+1

Partner Domains:

epwin.co.uk
parent
kayflow.co.uk
partner

+2 more partners

2026-07-10T07:20:52.948Z
carlainproperty.co.uk favicon

Carlain Student Houses

carlainproperty.co.uk

41
Real EstateUnited KingdomsmallHIGH

Carlain Student Houses operates as a specialist provider of student accommodation in Cheltenham, Gloucestershire, and Oxford. The company focuses on renting quality student houses located near college campuses, targeting students seeking convenient and comfortable living arrangements. Their market position is that of a niche real estate letting agency with a strong local presence and a portfolio of properties tailored to student needs. The website reflects a professional business model centered on property lettings and management services, supported by social media engagement and certifications that enhance trust. Technically, the website employs a moderately modern infrastructure including jQuery, Google Tag Manager, Google Analytics, and Google reCAPTCHA v3 for form security. The CMS appears to be CMS Made Simple, which is a common but somewhat dated platform. The site is mobile-optimized with good navigation and SEO practices, though some technical improvements could be made, such as updating libraries and adding security headers. From a security perspective, the site benefits from HTTPS and anti-bot measures on forms but lacks visible security headers and formal privacy or cookie policies, which are important for GDPR compliance. The absence of WHOIS data and domain registration details is a notable concern, potentially indicating domain registration irregularities. However, the website content and business information are consistent and professional, mitigating some trust concerns. Overall, the site presents a low to moderate risk profile with room for improvement in privacy compliance and security best practices. Strategic recommendations include implementing comprehensive privacy and cookie policies, enhancing security headers, updating technical components, and clarifying domain registration information to strengthen legitimacy and trust.

70
20
55
37
35
2
35
studentaccommodationlettingsrealestatecheltenhamgloucester+2 more
jQuery 1.12.4Google Tag ManagerGoogle Analytics (gtag.js)Google reCAPTCHA v3+1

Partner Domains:

www.clickandlet.co.uk
partner
2026-07-10T07:20:47.631Z
essex-commercial.co.uk favicon

Essex Commercial

essex-commercial.co.uk

49
TransportationUnited KingdomsmallHIGH

Essex Commercial is a UK-based small business specializing in commercial vehicle body repairs and resprays, serving clients primarily in Essex and surrounding areas. The company offers services for lorries, trucks, vans, and horse boxes, positioning itself as a local specialist with a focus on quality and customer satisfaction. The website reflects a professional and consistent brand image with clear contact details and client trust indicators such as logos from recognized brands. Technically, the website employs a modern JavaScript stack including jQuery, Modernizr, Google reCAPTCHA, and Google Tag Manager for analytics and spam protection. The site is mobile-optimized with good SEO practices but lacks visible advanced security headers and explicit cookie consent mechanisms. Performance is moderate, and accessibility is basic. From a security perspective, the site uses HTTPS and Google reCAPTCHA but does not show evidence of comprehensive security headers or incident response policies. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy. However, the website content and contact information suggest a legitimate business operation. Overall, the website scores moderately well in content quality, technical implementation, and business credibility but has room for improvement in security posture and privacy compliance. Strategic recommendations include enhancing security headers, implementing cookie consent, verifying domain registration, and publishing clear security and privacy policies.

20
60
57
85
68
30
2
commercialvehiclerepairbodyworkresprayessexvehiclerepair+1 more
jQuery 3.6.0Modernizr 3.11.2Google reCAPTCHAGoogle Tag Manager+4
2026-07-10T07:20:31.666Z
C

CAMB Machine Knives International Limited

camb-knives.co.uk

46
ManufacturingUnited KingdomsmallHIGH

CAMB Machine Knives International Limited is a UK-based manufacturer specializing in high-quality machine knives with over 25 years of experience. The company serves a global industrial audience, exporting to over 20 countries and providing additional services such as regrinding and re-sharpening of blades. Their website reflects a professional business with a clear product range and international agent network, positioning them as an established player in the manufacturing sector. Technically, the website is built on the concrete5 CMS platform and employs common web technologies including jQuery and Google Analytics. While the site is functional and moderately optimized for mobile, it uses an older CMS version and lacks some modern security headers and accessibility features. Security posture is adequate with HTTPS enabled and no visible vulnerabilities, but the absence of a published security policy and incident response contact reduces transparency. The WHOIS data for the domain is unavailable and indicates the domain name is invalid under Nominet UK rules, which raises concerns about domain legitimacy despite the professional website presence. Overall, the site is safe, business-focused, and trustworthy in content but would benefit from improved privacy compliance and security transparency.

57
70
65
20
50
30
2
manufacturingmachineknivesindustrialbladesukexport+1 more
jQueryNivo SliderGoogle AnalyticsGoogle Translate+3
2026-07-10T07:19:54.332Z
bridgegate-security.co.uk favicon

Bridgegate Security (UK) Limited

bridgegate-security.co.uk

62
HospitalityUnited KingdomlargeMEDIUM

Bridgegate Security (UK) Limited is a well-established security service provider specializing in hospitality security, door supervision, and event security across the United Kingdom. Founded in 1978, the company has grown to become one of the largest independent security contractors in the UK, serving bars, pubs, nightclubs, and venues with experienced SIA-licensed personnel. Their market position is reinforced by certifications such as the SIA Approved Contractor status and founding membership in the UK Door Security Association (UKDSA). The website reflects a professional and trustworthy business with clear service offerings and strong client testimonials. Technically, the website is built on WordPress with modern plugins including Yoast SEO and Cookie Law Info, ensuring good SEO and privacy compliance. The site is mobile-optimized, fast-loading, and accessible, with a comprehensive cookie consent mechanism that aligns with GDPR requirements. Hosting and domain registration are consistent with the business's UK location and history, registered with a reputable UK registrar. From a security perspective, the site uses HTTPS and implements cookie consent controls, but lacks explicit security headers and incident response contact details. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong with clear policies and consent mechanisms. Overall, the site demonstrates a mature security posture suitable for its business sector. The overall risk assessment is low, with recommendations to enhance security headers, publish incident response contacts, and consider a vulnerability disclosure policy to further strengthen trust and compliance.

60
62
100
85
20
2
80
securityhospitalitydoorsupervisioneventsecuritysiaapproved+2 more
WordPressYoast SEOSwiper SliderGoogle Tag Manager+1

Partner Domains:

bridgegatesecurity.live-website.com
partner
whistleblowing.paperform.co
service
2026-07-10T07:19:27.540Z
H

Hiltis UK Ltd

hiltis.co.uk

52
Real EstateUnited KingdomsmallMEDIUM

Hiltis UK Ltd is a small, family-oriented construction company based in the United Kingdom, specializing in general building work, new builds, extensions, and refurbishment projects primarily in Surrey. The company emphasizes quality craftsmanship, competitive pricing, and customer support, backed by a 6-year insurance guarantee under the JCT building contract. Their website reflects a professional and consistent brand image with clear service descriptions and customer testimonials, targeting residential and commercial property owners seeking reliable construction services. Technically, the website is built on WordPress using the Enfold theme and Avia Framework, incorporating standard web technologies such as jQuery and Google Web Fonts. The site is hosted by Ionos SE and uses HTTPS with a good SSL configuration. Mobile optimization and navigation clarity are good, though some SEO and accessibility features could be improved. The site includes a cookie consent mechanism compliant with GDPR, indicating awareness of privacy regulations. From a security perspective, the website enforces HTTPS and uses cookie consent banners but lacks explicit security headers and up-to-date WordPress core versions, which could expose it to vulnerabilities. No incident response or security policy information is publicly available. No suspicious or malicious content was detected, and the domain registration is consistent with the business history, enhancing trustworthiness. Overall, the website presents a trustworthy and professional image with room for technical and security improvements. Strategic recommendations include implementing security headers, updating WordPress and plugins, publishing security policies, and enhancing SEO and accessibility to strengthen digital maturity and security posture.

52
55
65
100
2
20
50
constructionbuildingrefurbishmentnewbuildextensions+2 more
jQueryGoogle Web FontsMediaElement.js
2026-07-10T07:19:20.725Z
groupfinancesolutions.com favicon

Group Finance Solutions Consulting

groupfinancesolutions.com

45
GovernmentUnited KingdomsmallHIGH

Group Finance Solutions Consulting (GFSC) is a specialist ERP advisory consultancy focused on supporting UK public sector and enterprise organizations. They provide independent, client-side advisory services across the full ERP program lifecycle, including ERP selection, implementation advisory, transformation, and Oracle Cloud expertise. The company positions itself as a trusted advisor helping organizations adopt best-practice cloud solutions and successfully deliver complex ERP programs. The website content is professional, well-structured, and targets UK public sector and enterprise clients. Technically, the website is built on WordPress using the Kadence theme and Kadence blocks, with modern web technologies such as lazy loading and Google Fonts. While the site is mobile-optimized and SEO-friendly, some technical improvements are possible, including configuring analytics properly and adding security headers. The site uses HTTPS, ensuring secure communication. From a security perspective, the site shows good basic practices but lacks visible security headers and formal privacy or cookie policies. The WHOIS data is missing or unavailable, which is a significant concern regarding domain legitimacy and trust. No signs of WAF or blocking mechanisms were detected, and the site content is fully accessible and safe for general audiences. Overall, the site is a credible business presence with room for improvement in privacy compliance and security hardening. The missing WHOIS data warrants further investigation to confirm domain registration legitimacy.

62
75
70
-
25
35
17
erporaclecloudconsultingukpublicsectorenterprise+2 more
WordPress 6.9.4Kadence ThemeKadence Blocks pluginGoogle Fonts (Inter)+2
2026-07-10T07:18:59.482Z
biomap.co.uk favicon

Biomap Limited

biomap.co.uk

57
HealthcareUnited KingdomsmallMEDIUM

Biomap Limited is a specialized provider of temperature monitoring and mapping services tailored for the Life Sciences industry, including pharmaceutical manufacturing, distribution, and clinical environments. Established in 2009, the company has built a strong reputation with nearly two decades of experience and a client base that includes major pharmaceutical and healthcare organizations. Their offerings encompass both services such as temperature mapping, packaging qualification, calibration, and shipping studies, as well as products like continuous monitoring systems and data loggers sourced from reputable partners. The website reflects a professional and consistent brand image, targeting B2B clients in healthcare and life sciences sectors primarily within the UK. Technically, the website is built on WordPress with modern front-end libraries and integrates Google Analytics, Google Tag Manager, and reCAPTCHA for tracking and security. The site is mobile-optimized and SEO-friendly with structured data and Open Graph metadata. However, some security best practices such as security headers and cookie consent mechanisms are missing, which could be improved to enhance compliance and security posture. Security-wise, the site uses HTTPS and employs reCAPTCHA on forms, but lacks explicit security policies and incident response information. No vulnerabilities or suspicious content were detected. The domain registration data is consistent with the business claims, showing a long-standing presence and no privacy protection, which supports legitimacy. Overall, Biomap Limited presents a credible, professional online presence with good technical implementation and business credibility. Strategic improvements in security headers, privacy compliance (cookie consent), and incident response transparency would further strengthen their security posture and regulatory compliance.

47
65
100
70
15
17
58
temperaturemappinglifesciencespharmaceuticaltemperaturemonitoringcalibration+2 more
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+4

Partner Domains:

cryopak.com
partner
labcold.com
partner

+1 more partners

2026-07-10T07:18:38.136Z
hippowaste.co.uk favicon

Waste Management Systems Ltd.

hippowaste.co.uk

67
TransportationUnited KingdommediumMEDIUM

HIPPO, operated by Waste Management Systems Ltd., is a well-established UK-based rubbish removal service provider with over 20 years of experience. The company offers a variety of waste disposal solutions including HIPPOBAG, Man and Van, Skip Hire, and trade waste services, targeting both residential and business customers across the UK. Their market position is strong, supported by certifications such as ISO14001 and ISO9001, and a high customer satisfaction rating on Trustpilot. The website reflects a professional and trustworthy brand with consistent branding and comprehensive service information. From a technical perspective, the website employs modern web technologies including jQuery, Google Tag Manager, Trustpilot widgets, and OneTrust for cookie consent management. The site is mobile-optimized with good SEO practices and moderate performance. Security posture is generally good with HTTPS enforced and cookie consent mechanisms in place, though some security headers are not explicitly detected and no public security policy or incident response contacts are found. The WHOIS data for the domain is incomplete and indicates an error related to domain naming rules, likely due to querying the 'www' subdomain instead of the root domain. Despite this, the website content and business information appear legitimate and professional. No adult or NSFW content is present, and privacy compliance is well addressed with clear policies and consent banners. Overall, HIPPO presents a credible and professional online presence with strong business credibility and good technical implementation. Security can be improved by adding explicit security headers and publishing incident response information. The WHOIS discrepancy should be clarified by querying the correct domain name.

77
65
100
75
2
73
65
rubbishremovalwastemanagementskiphirehippobagmanandvan+3 more
jQueryGoogle Tag ManagerTrustpilot WidgetOneTrust Cookie Consent+2
2026-07-10T07:18:06.232Z
T

TJ Williams Ltd

tjwilliams.co.uk

49
ManufacturingUnited KingdommediumHIGH

TJ Williams Ltd is a well-established UK-based manufacturer specializing in precision handcrafted pressure, level, and temperature instrumentation with over 150 years of industry presence. The company offers a comprehensive range of products including pressure gauges, calibration and repair services, bespoke designs, and acts as an official distributor for Kobold UK. Their market position is strong within the industrial manufacturing sector, targeting engineers and industrial clients requiring reliable instrumentation solutions. Technically, the website is built on a modern WordPress CMS with WooCommerce integration, leveraging Themify Ultra theme and jQuery libraries. The site is hosted via Cloudflare, ensuring good performance and security at the network level. Mobile optimization and SEO practices are well implemented, although accessibility features could be improved. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks several recommended security headers and a cookie consent mechanism, which impacts GDPR compliance. No explicit security policies or incident response contacts are published, indicating room for improvement in security transparency and readiness. Overall, the website is professional, trustworthy, and business-focused with a solid technical foundation. Strategic enhancements in privacy compliance and security best practices would further strengthen the company's digital maturity and customer trust.

57
20
70
65
20
17
58
pressuregaugesmanufacturingindustrialinstrumentationcalibrationrepair+2 more
WordPress 7.0WooCommerce 10.9.3jQueryThemify Ultra Theme+2

Partner Domains:

kobold.com
partner
2026-07-10T07:16:35.887Z
dalrod.co.uk favicon

DALROD

dalrod.co.uk

52
OtherUnited KingdommediumMEDIUM

DALROD UK Ltd is a professional drainage service provider offering expert 24/7 rapid response drainage solutions across the United Kingdom. Their services include drain cleaning, unblocking, repairs, CCTV surveys, liquid waste disposal, and emergency drainage services. The company positions itself as a trusted and accredited provider with over 35 years of experience, serving both residential and commercial customers nationwide. The website reflects a mature digital presence with comprehensive service descriptions, customer testimonials, and multiple industry certifications, indicating a strong market position. Technically, the website is built on WordPress using Elementor and Yoast SEO plugins, integrating modern analytics and marketing tools such as Google Analytics, Microsoft Clarity, and Trustist reviews. The site is mobile-optimized, accessible, and SEO-friendly, with a cookie consent mechanism in place to comply with privacy regulations. The technical infrastructure is solid, though some security headers could be improved to enhance security posture further. From a security perspective, the site enforces HTTPS and employs consent-based tracking, demonstrating good privacy compliance. No critical vulnerabilities or exposed sensitive data were detected. However, the WHOIS lookup for the subdomain 'www.dalrod.co.uk' failed due to a naming rules violation, likely because the query was made on the subdomain rather than the registered domain 'dalrod.co.uk'. This does not detract from the legitimacy of the business as evidenced by the website content and structured data. Overall, DALROD presents a trustworthy and professional online presence with strong business credibility and compliance. Strategic improvements in security headers and ongoing monitoring of third-party scripts are recommended to maintain and enhance security posture.

40
57
65
75
80
15
2
drainagedrainrepairdrainunblockingcctvdrainsurveysemergencyservices+3 more
WordPressElementorYoast SEOGoogle Tag Manager+3
2026-07-10T07:16:30.535Z
C

Car Concierge

carconciergeservice.co.uk

46
TransportationUnited KingdomsmallHIGH

Car Concierge, operating under the brand Abels Car Concierge Service, is a UK-based company specializing in premium vehicle storage, transportation, and shipping services. Established since at least 2010, the company holds a prestigious Royal Warrant, underscoring its reputation for quality and reliability. The website clearly targets vehicle owners seeking secure and professional car storage and transport solutions across the UK, Europe, and worldwide. The business model focuses on service provision with a strong emphasis on trust and heritage. Technically, the website is built on WordPress with a moderate technology stack including popular plugins for analytics, forms, and UI enhancements. The site is moderately optimized for performance and mobile use, with good SEO practices evident in metadata and structured data. However, accessibility and advanced mobile optimization are basic. Security posture is adequate with HTTPS enforced and no exposed sensitive data, but lacks advanced HTTP security headers and visible security policies. From a security and compliance perspective, the site does not display explicit privacy or cookie consent mechanisms, which may pose GDPR compliance risks. There is no published incident response or vulnerability disclosure information. The domain registration data aligns well with the business claims, supporting legitimacy. Overall, the site is professional and trustworthy but could improve in privacy compliance and security transparency. Strategically, the company should prioritize implementing cookie consent and privacy enhancements, publish clear security policies, and adopt security headers to strengthen its security posture and regulatory compliance. These improvements will enhance customer trust and reduce risk exposure.

47
85
60
20
15
58
2
carstorageluxurycartransportclassiccartransportationcarshippingvehicleremovals+2 more
WordPressPHPjQueryGoogle Analytics+6

Partner Domains:

abels.co.uk
partner
blueskycreativeuk.com
partner
2026-07-10T07:16:19.909Z
merewaykitchens.co.uk favicon

Mereway Kitchens

merewaykitchens.co.uk

49
RetailUnited KingdommediumHIGH

Mereway Kitchens is a UK-based manufacturer specializing in high-quality kitchen furniture, supplying an extensive network of independent retail outlets nationwide. With over 30 years of experience, the company emphasizes handcrafted kitchens using traditional materials and methods, positioning itself as a reputable player in the retail and manufacturing sectors. The website reflects a professional and consistent brand image, supported by numerous customer testimonials and industry certifications such as KBSA and HouseBeautiful Awards. Technically, the website is built on Joomla CMS and leverages popular libraries and frameworks including jQuery, Bootstrap, and UIkit. The site demonstrates moderate performance and good mobile optimization, though accessibility and SEO optimizations are basic. No advanced analytics or tracking tools are detected, indicating a minimal user tracking approach. From a security perspective, the site lacks critical security headers and explicit security policies. There is no evidence of HTTPS enforcement or privacy and cookie policies, which are essential for compliance and user trust. The WHOIS data presents a significant anomaly with a domain creation date set in the future, which conflicts with the company's stated history and raises questions about data accuracy or domain registration details. Overall, the website is functional and professional but requires improvements in security posture, privacy compliance, and WHOIS data verification to enhance trustworthiness and regulatory adherence.

37
60
100
60
15
17
35
kitchenfurnituremanufacturingretailuk+3 more
jQueryBootstrapUIkitJCEMediaBox
2026-07-10T07:16:09.254Z
S

STS 2000 Ltd.

sts2000.co.uk

51
RetailUnited KingdomsmallMEDIUM

STS 2000 Ltd. is a UK-based small business specializing in EPOS field engineering and support services, targeting retail and hospitality sectors. Their offerings include installation, maintenance, and PAT testing of EPOS systems. The website presents a basic but clear description of their services and target audience, positioning them as a niche service provider in their market segment. The domain is well-established since 2007, indicating a mature business presence. Technically, the website is built with standard HTML, CSS, and JavaScript without advanced frameworks or CMS. The site demonstrates basic mobile optimization and accessibility but lacks advanced SEO and performance enhancements. No analytics or marketing tools are detected, suggesting minimal digital marketing infrastructure. From a security perspective, the site lacks HTTPS enforcement and security headers, which are critical for protecting user data and ensuring trust. There are no visible privacy or cookie policies, nor contact details for security incident response, indicating gaps in compliance and security posture. No vulnerabilities or exposed sensitive data were detected in the provided content. Overall, the website is functional but basic, with moderate trustworthiness. Strategic improvements in security, privacy compliance, and technical modernization are recommended to enhance business credibility and protect customer data.

49
65
60
100
2
50
30
eposfieldengineerretailhospitalitysupportservices
HTML5CSSJavaScript
2026-07-10T07:15:53.047Z
alsecco.co.uk favicon

alsecco UK Ltd

alsecco.co.uk

49
ManufacturingUnited KingdommediumHIGH

alsecco UK Ltd is a well-established UK-based manufacturer and supplier specializing in rainscreen cladding, external wall insulation, paints, and plasters designed to create iconic façades. Founded in 1999 and operating under the parent company DAW SE, alsecco UK serves primarily B2B clients including architects, builders, and real estate developers. Their product offerings emphasize innovation, sustainability, and affordability, positioning them as a reputable player in the construction and manufacturing sectors. Technically, the website is built on WordPress with modern frameworks such as UIkit and employs industry-standard plugins like Yoast SEO and Cookiebot for SEO and privacy compliance respectively. The site demonstrates good mobile optimization and accessibility, though some performance improvements could be made. Analytics tools include Google Analytics and Piwik Pro, with moderate user tracking balanced by strong cookie consent mechanisms. From a security perspective, the site benefits from HTTPS encryption and cookie consent management but lacks explicit security headers and publicly available security or incident response policies. No critical vulnerabilities or exposed sensitive data were detected. The domain registration is consistent and long-standing, reinforcing the legitimacy of the business. Overall, alsecco UK presents a professional, trustworthy online presence with strong compliance to privacy regulations and a solid technical foundation. Strategic improvements in security policy transparency and analytics configuration could further enhance their digital maturity and trustworthiness.

47
75
20
65
15
83
2
rainscreencladdingexternalwallinsulationpaintplasterfaades+3 more
WordPress 6.7.5Yoast SEO pluginjQuery 3.7.1Responsive Flipbook plugin+3

Partner Domains:

daw.de
parent
caparol.co.uk
partner
2026-07-10T07:15:36.971Z
quadcom.co.uk favicon

Quadrant Communications Ltd.

quadcom.co.uk

56
HealthcareUnited KingdomsmallMEDIUM

Quadrant Communications Ltd. is a UK-based boutique design and marketing communication agency with over 25 years of experience, specializing in creative design solutions primarily for the healthcare sector and other industries. The company offers a broad range of services including brand positioning, print and digital marketing, web design, video production, and social media management. Their client portfolio includes reputable organizations such as GE, Bayer, and Janssen, indicating a strong market position and trusted partnerships. Technically, the website employs a modern yet straightforward tech stack including HTML5, CSS3, JavaScript with jQuery and Modernizr, and integrates Google reCAPTCHA v3 for form security. The site is mobile optimized with good SEO practices and a responsive design, though some improvements in accessibility and security headers are recommended. From a security perspective, the site benefits from HTTPS and reCAPTCHA integration, but lacks explicit security headers and an incident response policy. The WHOIS data is unavailable due to domain registration issues, which raises concerns about domain legitimacy despite the professional website content. No vulnerabilities or exposed sensitive data were detected. Overall, the website presents a professional and trustworthy front for the business, but the domain registration inconsistency should be investigated further. Strategic recommendations include enhancing security headers, updating legacy libraries, and clarifying domain registration status to improve trust and compliance.

65
100
62
55
2
68
20
designagencymarketinghealthcarecreativeuk+4 more
HTML5CSS3JavaScriptjQuery 1.8.1+3
2026-07-10T07:13:59.740Z
walsingham.com favicon

Walsingham Support

walsingham.com

57
Non-profitUnited KingdommediumMEDIUM

Walsingham Support is a well-established UK-based charity providing personalized support services for individuals with learning disabilities, autism, brain injuries, and complex needs. With over 40 years of experience, the organization offers bespoke support solutions ranging from a few hours weekly to full 24/7 care. The website reflects a professional and consistent brand image, targeting individuals and families seeking specialized disability support. The charity emphasizes its commitment to quality of life and happiness for its clients. Technically, the website employs a modern technology stack including jQuery, Google Tag Manager, and a proprietary CMS (Grandad Digital). It is mobile-optimized, accessible, and includes cookie consent mechanisms aligned with GDPR requirements. Analytics tools such as Google Analytics and Hotjar are used with user consent. However, some security best practices such as explicit security headers and published security policies are missing. From a security perspective, the site uses HTTPS and manages cookie consent effectively, but lacks visible security policies and incident response contacts. The WHOIS data is unavailable, which raises concerns about domain registration legitimacy and consistency with the claimed 40-year history. No critical vulnerabilities or unsafe content were detected. Overall, the website is professional and trustworthy in content and design but would benefit from improved transparency in domain registration and enhanced security documentation to strengthen trust and compliance.

70
75
100
37
15
83
2
charitydisabilitysupportnon-profitlearningdisabilitiesautism+3 more
jQueryjQuery UIGoogle Tag ManagerGoogle Analytics+2
2026-07-10T07:13:33.156Z
highlandwholefoods.co.uk favicon

Highland Wholefoods Workers Cooperative Limited Inverness

highlandwholefoods.co.uk

54
RetailUnited KingdomsmallMEDIUM

Highland Wholefoods Workers Cooperative Limited Inverness operates as a cooperative retailer and wholesaler specializing in vegetarian, vegan, gluten-free, organic, ethical, and eco-friendly food and household products. Established since 1989, it serves the Highlands, Islands, and northeast Scotland with over 5,000 products, targeting families, businesses, and community groups. The business model focuses on ethical shopping and community engagement with physical showrooms and online ordering capabilities. Technically, the website is built on the Spanglefish platform, utilizing legacy JavaScript libraries such as jQuery 1.8.2 and jQuery UI 1.8.13, with assets hosted on Amazon S3. The site demonstrates basic mobile optimization and SEO practices but lacks modern security headers and uses outdated libraries, which pose security risks. Privacy and cookie policies exist but lack active consent mechanisms. Security posture is moderate; HTTPS is implied but no advanced security headers or incident response contacts are visible. The WHOIS lookup failed due to an invalid domain query, limiting verification of domain registration legitimacy. No critical vulnerabilities or malware indicators were found, but outdated libraries and missing security headers reduce the security score. Overall, the website is functional and trustworthy from a business perspective but requires technical and security improvements to enhance compliance, security posture, and user trust. Strategic recommendations include updating JavaScript libraries, implementing security headers, adding cookie consent mechanisms, and clarifying domain registration details.

70
47
60
100
15
68
2
organicvegangluten-freeethicalshoppingcooperative+4 more
jQuery 1.8.2jQuery UI 1.8.13Superfish menu pluginFancybox 1.3.4+2
2026-07-10T07:10:23.368Z
silvershieldwindscreens.co.uk favicon

Silver Shield Windscreens

silvershieldwindscreens.co.uk

50
TransportationUnited KingdomsmallMEDIUM

Silver Shield Windscreens is a UK-based company specializing in automotive glass repair and replacement services, including windscreen repairs, replacements, fleet services, specialist glazing, and ADAS recalibration. The company targets fleet owners, business owners, and private vehicle owners across England and Wales, emphasizing quality service at competitive prices with trained technicians and insurance claim support. The website presents a professional image with clear contact details and service descriptions. Technically, the website employs legacy technologies such as jQuery 1.8.3 and Modernizr 2.6.2, alongside Google Analytics and Tag Manager for tracking. The site is mobile-optimized with a cookie consent mechanism, but lacks visible modern security headers and uses an outdated JavaScript library, which may pose security risks. Performance is moderate, and SEO practices are adequately implemented. From a security perspective, the site uses HTTPS (assumed from external scripts loaded via HTTPS), but no explicit security headers were detected in the provided data. The cookie consent banner and privacy policies indicate GDPR compliance efforts, though no incident response or vulnerability disclosure information is present. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy, though the website content is consistent with a legitimate business. Overall, the website is functional and professional but would benefit from technical and security improvements, including updating libraries, implementing security headers, and clarifying domain registration status to enhance trust and compliance.

47
60
85
20
15
95
2
windscreenrepairwindscreenreplacementfleetservicesadasrecalibrationspecialistglazing+3 more
jQuery 1.8.3Google AnalyticsGoogle Tag ManagerModernizr 2.6.2+1
2026-07-10T07:09:34.977Z
bishoptonvets.co.uk favicon

Bishopton Veterinary Group

bishoptonvets.co.uk

65
HealthcareUnited KingdommediumMEDIUM

Bishopton Veterinary Group is an established independent veterinary practice based in Yorkshire, UK, with over 80 years of experience. The company provides a broad range of veterinary services including small animal care, farm animal services, pig herd health consulting, and equine veterinary care. They operate multiple branches across Yorkshire and offer 24-hour emergency cover, positioning themselves as a trusted regional veterinary provider. Their business model focuses on comprehensive animal healthcare with additional offerings such as a Lifetime Care Club to support preventative care budgeting for pet owners. Technically, the website is built on an ASP.NET WebForms platform with a mix of legacy and modern web technologies including jQuery, Google reCAPTCHA v3, and Slick Carousel. The site is mobile optimized with good SEO practices and a professional design. While the CMS appears proprietary or custom, the infrastructure supports a moderate performance level and basic accessibility features. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect its contact form from spam. However, it lacks some modern security headers and does not publish explicit security or incident response policies. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with a clear privacy policy and cookie consent mechanism. The WHOIS lookup failed due to querying a subdomain rather than the registered domain, but the website content and company registration details strongly indicate legitimacy. Overall, Bishopton Veterinary Group's website demonstrates a solid business presence with good technical and security practices. Strategic improvements in security headers, incident response transparency, and updating legacy libraries would further enhance their security posture and trustworthiness.

65
100
70
74
60
68
2
veterinarypetsfarmequinehealthcare+2 more
ASP.NET WebFormsjQuery 1.9.1AjaxControlToolkitSlick Carousel+4
2026-07-10T07:09:13.254Z
geobear.co.uk favicon

Geobear UK

geobear.co.uk

66
Real EstateUnited KingdommediumMEDIUM

Geobear UK is a specialized ground engineering company focused on providing fast, non-disruptive solutions for residential and commercial foundation problems caused by subsidence. The company positions itself as a niche expert in subsidence repair across the UK, targeting homeowners and commercial property owners. Their key services include subsidence repair, residential foundation stabilization, and infrastructure ground engineering. The website reflects a professional and consistent brand image with clear navigation and contact options, supporting their market position. Technically, the website is built on the HubSpot CMS platform, utilizing modern technologies such as Bootstrap for responsive design, Google Tag Manager for analytics management, and Cookiebot for privacy compliance. The site is mobile-optimized and demonstrates good SEO and accessibility practices. Hosting appears to be supported by Cloudflare, enhancing performance and security. From a security perspective, the website enforces HTTPS and employs cookie consent mechanisms that comply with GDPR. Security headers are partially detected or implied, and no critical vulnerabilities or exposed sensitive data were found in the content. The WHOIS data is privacy-protected, which is common for businesses of this type, and does not raise immediate trust concerns given the professional website presence. Overall, the website presents a low-risk profile with strong business credibility and good privacy compliance. Strategic recommendations include enhancing explicit security headers, continuous monitoring of third-party scripts, and ensuring robust form security to maintain and improve the security posture.

75
100
49
70
95
2
50
subsidencefoundationrepairgroundengineeringukconstruction+4 more
HubSpot CMSGoogle Tag ManagerCookiebotBootstrap+2

Partner Domains:

villaagare.geobear.com
subsidiary
underpinning.geobear.com
subsidiary

+3 more partners

2026-07-10T07:08:52.027Z