Skip to main content

Austria security reports

Browse 3,498 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157364
Websites
130
Industries
113
Countries
52
Avg Score
Page 60 of 70|Showing 2951-3000 of 3498
R

RUBICON IT GmbH

rubicon.eu

40
TechnologyAustriamediumHIGH

RUBICON IT GmbH is a medium-sized Austrian technology company specializing in digitalization solutions and IT services. Their product portfolio includes leading software such as Nova Find, a prominent lost and found software in Europe, alongside other enterprise solutions like Acta Nova and Document Partner. The company also offers professional services, managed services, and training, targeting business and public sector clients seeking digital transformation. The website is professionally designed, multilingual, and well-structured, reflecting a mature digital presence. Technically, the site is built on WordPress with various plugins and frameworks, including ASP.NET components, but suffers from critical SSL/TLS misconfigurations, lacking a valid certificate and modern protocol support. Security headers are partially implemented but incomplete, and no advanced security mechanisms like OCSP stapling or session resumption are enabled. Privacy compliance is strong, with clear cookie consent and a comprehensive privacy policy. Social media integration and certifications like Kubernetes demonstrate trust and industry alignment. Overall, the site is functional and business-credible but requires urgent security improvements to protect user data and enhance trust.

45
33
5
50
-
85
100
digitalizationsoftwareitservicesmanagedservicesprofessionalservices+4 more
WordPressPHPASP.NET (X-Powered-By header)jQuery+8

Partner Domains:

nova-find.eu
partnerpending
signpath.io
partnerpending
2025-06-15T21:51:17.233Z
bkp.at favicon

BRAUNEIS RECHTSANWÄLTE GMBH

bkp.at

24
OtherAustriamediumCRITICAL

BRAUNEIS RECHTSANWÄLTE GMBH is a professional law firm based in Vienna, Austria, specializing in corporate and commercial law, litigation, and real estate legal services. The firm targets national and international companies, investors, developers, local authorities, law firms, and private individuals. It holds a reputable market position supported by rankings from Chambers Global and Legal 500, and features client testimonials that reinforce its credibility. The website reflects a professional and consistent brand image with excellent content quality and user experience. Technically, the website uses Apache server technology, Alpine.js for frontend interactivity, Algolia for search functionality, and Matomo for privacy-conscious analytics. The site is mobile optimized and accessible, but performance metrics are not provided. Hosting appears to be with a1.net DNS and a dedicated IP address. SEO and navigation are well implemented. Security-wise, the site lacks a valid SSL/TLS certificate, resulting in no HTTPS support, which is a critical vulnerability. Other security best practices such as HSTS, DMARC, DNSSEC, and CAA records are missing. No explicit security or incident response policies are published. The cookie consent mechanism is implemented and GDPR compliant, indicating good privacy compliance. Overall, the website is trustworthy and professional but requires urgent security improvements, especially enabling HTTPS to protect user data and improve trust. Strategic recommendations include installing a valid SSL certificate, enabling security headers, and publishing security policies to enhance the security posture and compliance.

15
-
5
50
-
75
20
lawfirmlegalservicescorporatelawlitigationrealestate+1 more
ApacheAlpine.jsAlgolia DocSearchMatomo Analytics
2025-06-15T21:51:17.085Z
jawa.at favicon

JAWA Management Software GmbH

jawa.at

23
TechnologyAustriamediumCRITICAL

JAWA Management Software GmbH is an established Austrian technology company specializing in customized software solutions for process optimization and information management. Their flagship product, the inforum management platform, supports supplier management, quality control, production planning, and AI-enhanced business solutions. With over 25 years of market presence and a medium-sized operation, JAWA serves a broad international clientele with a focus on efficiency and productivity improvements. Technically, the website is built on a modern WordPress CMS infrastructure using popular plugins and frameworks such as WPBakery, WPML, and Woodmart theme. The site is well-structured, mobile-optimized, and SEO-friendly, demonstrating a mature digital presence. However, the hosting environment lacks a valid SSL certificate and proper TLS configuration, which significantly undermines the security posture. Security-wise, the absence of HTTPS and modern TLS protocols is a critical vulnerability, exposing users to potential data interception and trust issues. While no active vulnerabilities or malware are detected, the site misses essential security headers and DNS security configurations. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms. Overall, the website presents a professional and credible business front but requires urgent security improvements to protect user data and enhance trust. Strategic recommendations include immediate SSL deployment, enabling modern security protocols, and implementing advanced security headers and DNS protections.

15
-
5
50
-
85
20
softwaremanagementprocessoptimizationtechnologybusinesssolutions+3 more
ApacheWordPress 6.8.1PHPjQuery+9
2025-06-15T21:51:16.418Z
wunderweiss.com favicon

wunderweiss

wunderweiss.com

40
TechnologyAustriasmallHIGH

Wunderweiss is a specialized agency based in Austria focusing on software and design development, with a strong emphasis on AI applications integrated into CMS systems, UI/UX consulting, and corporate branding. The company targets businesses seeking innovative technology and design solutions, positioning itself as an expert in user-oriented design and AI-driven application development. The website presents a professional and consistent brand image with detailed project showcases and clear service offerings. Technically, the website employs modern web technologies including jQuery, Django Framework, and Wagtail CMS, hosted behind Cloudflare. However, the site suffers from a critical security issue: the SSL certificate is invalid or missing, resulting in no proper HTTPS support. This significantly impacts the security posture and user trust. Performance metrics are not available, but the site shows good mobile optimization and basic accessibility features. Security-wise, the site implements several important HTTP security headers such as X-Frame-Options and Referrer-Policy, but lacks a valid SSL certificate, OCSP stapling, and session resumption. There is no visible incident response or vulnerability disclosure information. Privacy compliance is partially addressed with a comprehensive privacy policy, but no cookie consent mechanism is present. Overall, the website is professionally designed and credible from a business perspective but requires urgent remediation of its SSL configuration to improve security and trust. Strategic recommendations include fixing HTTPS, implementing cookie consent, and adding security and incident response policies.

65
-
5
50
-
85
100
aidesigntechnologysoftwaredevelopmentuiux+2 more
jQueryCloudflareGoogle Calendar integrationJavaScript+3
2025-06-15T21:51:14.554Z
ivii.eu favicon

ivii GmbH

ivii.eu

40
TechnologyAustriasmallHIGH

ivii GmbH is a small Austrian technology company specializing in AI-powered visual intelligence systems designed to optimize quality assurance and logistics processes in industrial manufacturing environments. Their flagship product, ivii iriis, combines artificial intelligence, machine learning, and camera technology to enable error-free production and logistics workflows. The company positions itself as an innovative provider with a strong focus on practical, plug-and-play solutions that empower employees and improve operational efficiency. The website content is professionally crafted, targeting industrial and logistics sectors, and supported by customer testimonials and ISO 27001 certification, enhancing trust and credibility. Technically, the website is built on WordPress with modern SEO and performance plugins such as Yoast SEO Premium and WP Rocket. However, the site suffers from a critical security shortfall due to the absence of a valid SSL certificate and HTTPS support, which significantly impacts its security posture. Performance is also suboptimal with a high page load time. Privacy compliance is well addressed with comprehensive GDPR-compliant privacy and cookie policies, including a consent mechanism. The company maintains active social media profiles and provides clear contact information. Security-wise, the lack of HTTPS and modern TLS protocols, absence of security headers, and missing DNSSEC and CAA records expose the site to potential risks. While no active vulnerabilities or WAF blocks are detected, these gaps should be addressed promptly to protect user data and maintain trust. Overall, ivii GmbH demonstrates a strong business and content presence but must urgently improve its security infrastructure to align with best practices and industry standards. Strategic recommendations include implementing SSL/TLS, enabling security headers, and optimizing performance to enhance user experience and trust.

70
-
5
50
-
85
100
aiindustrialvisionqualityassurancelogisticsmanufacturing+3 more
WordPress 6.8.1Yoast SEO PremiumWP RocketBorlabs Cookie+3
2025-06-15T21:51:04.882Z
motion06.at favicon

motion06 gmbh

motion06.at

23
TransportationAustriamediumCRITICAL

motion06 GmbH is a medium-sized Austrian company specializing in the manufacture and supply of advanced conveyor systems primarily for airport baggage handling, ecommerce logistics, and industrial intralogistics. As a global leader in its niche, motion06 offers customized hardware and software solutions to optimize logistics processes. The company operates under the parent company Duravant, reflecting a strong corporate backing and market presence. The website content is well-structured, professionally designed, and targets logistics and industrial sectors with clear product and service offerings. Technically, the website is built on WordPress with a modern tech stack including jQuery, Bootstrap, and marketing integrations such as Google Analytics and Marketo. However, the site lacks HTTPS encryption, which is a critical security flaw. Performance metrics are missing but inferred to be slow. Mobile optimization and SEO are adequately addressed, though accessibility is basic. From a security perspective, the absence of SSL/TLS and security headers significantly lowers the security posture. While cookie consent and privacy policies are implemented and GDPR compliant, there is no visible security or incident response policy. The domain registration data is consistent with the business claims, enhancing trustworthiness. Overall, the website presents a professional business front but requires urgent security improvements, especially implementing HTTPS and enhancing security headers, to protect user data and improve trust. Strategic recommendations include upgrading security infrastructure, publishing security policies, and improving performance metrics for better user experience.

15
-
-
50
-
85
20
conveyorsystemsairportbaggagehandlingintralogisticsindustrialsolutionsecommercelogistics+2 more
Apache 2.4.62Debian LinuxWordPress 6.6.2WPBakery Page Builder+9

Partner Domains:

duravant.com
parentpending
2025-06-15T21:51:03.283Z
cyledge.com favicon

CYLEDGE

cyledge.com

40
TechnologyAustriamediumHIGH

CYLEDGE is a consulting firm specializing in collaboration, customer centricity, and incremental innovation to create sustainable value. With over 20 years of market experience, the company offers tailored advisory services including value proposition design, organizational development, customer experience, and coaching. Their client portfolio includes notable companies such as VW, Siemens, and Redbull, indicating a strong market position in the technology and consulting sectors. Technically, the website is built on the Wix Studio platform using modern React 18 technology, with integrated Wix Blog and Forms for content and user engagement. However, the site suffers from slow performance and lacks a valid SSL certificate, which impacts security and user trust. Mobile optimization and accessibility are well addressed, but SEO could be improved. From a security perspective, the site lacks HTTPS and advanced security headers, which is a significant risk. No explicit security or incident response policies are found, and no vulnerabilities are detected in the current analysis. Privacy compliance is adequate with clear privacy and cookie policies, including consent mechanisms. Overall, CYLEDGE presents a professional and trustworthy business with a strong digital presence but should prioritize improving security configurations and website performance to enhance user trust and compliance.

-
33
5
50
-
85
100
consultinginnovationcustomerexperiencedigitaltransformationwix+2 more
Wix StudioReact 18Wix BlogWix Forms+7
2025-06-15T21:51:00.811Z
wgkk.at favicon

Österreichische Gesundheitskasse

wgkk.at

40
HealthcareAustriaenterpriseHIGH

The Österreichische Gesundheitskasse (ÖGK) operates as a major public healthcare insurance provider in Austria, offering a broad range of health-related services and information to insured individuals, employers, and contract partners. The website serves as a comprehensive portal for health facilities, health services, customer support, appointment scheduling, and career opportunities, targeting Austrian residents and stakeholders in the healthcare sector. The organization maintains a consistent and professional online presence with clear branding and trust signals, including official government domain usage and social media engagement. Technically, the website is built on a mature infrastructure utilizing Apache, Jakarta Faces (JSF), jQuery 3.6.0, and Gentics CMS. It integrates advanced features such as a content slider and Piwik PRO analytics for user behavior tracking. However, performance metrics appear incomplete, and the site shows moderate loading characteristics. Accessibility and SEO optimizations are well addressed, with good mobile responsiveness and clear navigation. From a security perspective, the site implements several best practices including a detailed Content-Security-Policy and HttpOnly, Secure cookie flags. Nevertheless, the absence of a valid SSL certificate and HTTPS support is a critical vulnerability, severely impacting the security posture. Other SSL/TLS features such as modern protocol support, OCSP stapling, and session resumption are missing. Privacy compliance is strong, with GDPR-aligned cookie consent mechanisms and clear privacy policies. Overall, the website is trustworthy and professionally managed but requires urgent security improvements to enable HTTPS and strengthen SSL/TLS configurations. Addressing these issues will enhance user trust, data protection, and compliance with modern security standards.

50
-
5
50
-
85
100
healthcarepublicservicegovernmentsocialinsuranceaustria
ApachejQuery 3.6.0Jakarta Faces (JSF)Slick Carousel+1

Partner Domains:

sozvers.at
partnerpending
gesundheitskasse.at
partnerpending

+1 more partners

2025-06-15T21:50:56.149Z
medizin-medien.at favicon

MedTriX Group

medizin-medien.at

40
HealthcareAustriamediumHIGH

MedTriX Group is a specialized medical communication service provider with a strong presence in Austria, Germany, and Switzerland. The company offers unique healthcare professional (HCP) data intelligence and a broad portfolio of services including data targeting, CRM data quality enhancement, telephone communication, medical media publishing, digital newsletters, and educational events. Their market position is reinforced by a strong regional footprint and partnerships with sister companies MTX Schweiz and MTX Deutschland. Technically, the website is built on WordPress with Elementor and Yoast SEO, indicating a modern CMS and SEO-friendly infrastructure. However, performance metrics are lacking, and the SSL/TLS configuration is critically flawed with no valid certificate and no TLS protocols enabled, which severely impacts security and trust. Security posture is weak due to the invalid SSL certificate and incomplete TLS support, despite the presence of several security headers. Privacy compliance is strong with a clear privacy policy, cookie consent mechanism, and GDPR adherence. Contact information is comprehensive and professionally presented, enhancing business credibility. Overall, the site is functional and professional but requires urgent remediation of SSL/TLS issues to ensure secure communications and maintain trust. Strategic improvements in security configuration and performance optimization are recommended.

85
-
5
50
-
85
100
healthcaremedicalcommunicationdataintelligencemedtrixgroupaustria+5 more
WordPress 6.8.1Elementor 3.29.1Yoast SEO 25.2jQuery 3.7.1+3
2025-06-15T21:50:52.653Z
poloplast.com favicon

POLOPLAST GmbH & Co KG

poloplast.com

40
ManufacturingAustrialargeHIGH

POLOPLAST GmbH & Co KG is a well-established Austrian manufacturer specializing in plastic pipe systems with a strong presence across Europe. The company emphasizes sustainability, innovation, and quality, offering a broad range of products including multilayer pipe systems, building drainage, and wastewater disposal solutions. Their market position is that of a technology leader with a large operational scale and a parent company affiliation with Wietersdorfer. The website reflects a professional business with clear contact information and comprehensive privacy and cookie policies, supporting GDPR compliance. Technically, the website is built on TYPO3 CMS and uses modern web technologies including Bootstrap for responsive design. However, the site suffers from slow performance and lacks HTTPS support, which is a critical security concern. The absence of SSL/TLS encryption and security headers exposes the site to potential risks and undermines user trust. Analytics and tracking tools such as Google Analytics and LeadFeeder are used with appropriate cookie consent mechanisms. Security posture is weak due to the lack of HTTPS and security headers, though no active vulnerabilities or malware were detected. Privacy compliance is strong with clear policies and consent banners. Business credibility is high given the detailed company information and social media presence. Overall, the site is functional and professional but requires urgent security improvements to protect user data and enhance trust. Strategic recommendations include immediate implementation of a valid SSL certificate, addition of security headers, performance optimization, and enhancement of incident response information to strengthen security culture and compliance.

70
18
5
50
-
90
100
pipesystemmultilayerpipesystembuildingdrainagemulti-layerplasticpipesystems+2 more
TYPO3 CMSJavaScriptCSSSVG icons
2025-06-15T21:50:49.439Z