Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 995 of 1064|Showing 49701-49750 of 53176
arqgroup.com favicon

ARQ

arqgroup.com

45
FinanceMaltamediumHIGH

ARQ Group is a Malta-based professional services organization specializing in corporate advisory, tax, compliance, licensing, accounting, and investment migration services. With over 20 years of experience, ARQ positions itself as a comprehensive partner for businesses seeking to establish and grow in Malta, particularly in sectors such as financial services and iGaming. The website reflects a mature business with a clear market position and a broad service offering tailored to local and international clients. Technically, the website is built on WordPress using the Divi theme, incorporating modern JavaScript libraries and Google Tag Manager for analytics. The site demonstrates good SEO practices, mobile optimization, and a professional design, although accessibility features could be enhanced. Performance is moderate, with no critical technical issues detected. From a security perspective, the site enforces HTTPS and includes some security headers, with no exposed sensitive data or vulnerable libraries identified. However, it lacks a visible cookie consent mechanism and published security or incident response policies, which are recommended for compliance and trust. The domain registration data aligns well with the business claims, indicating a legitimate and established entity. Overall, ARQ Group's website presents a professional and trustworthy digital presence with minor areas for improvement in privacy compliance and security transparency.

60
40
5
85
-
85
-
corporateservicesadvisorytaxcompliancemalta+3 more
WordPressDivi ThemejQueryMediaElement.js+1

Partner Domains:

arqeducate.com
partner
ofion.mt
partner
2025-06-21T18:21:54.989Z
C

Cardinal Health

cardinalhealth.com

62
HealthcareUnited StatesenterpriseMEDIUM

Cardinal Health is a large, enterprise-level healthcare services and distribution company focused on improving the cost-effectiveness of healthcare. Their website presents comprehensive information about their healthcare services, medical and pharmaceutical products, supply chain logistics, and specialty distribution services. The company targets healthcare providers, hospitals, pharmacies, manufacturers, and specialty physician practices. The website is professionally designed, well-structured, and optimized for both desktop and mobile users. Technically, the site leverages modern technologies including Adobe Experience Manager as the CMS, jQuery, Adobe Dynamic Media, Coveo Search, Google Tag Manager, and OneTrust for cookie consent management. The site uses HTTPS with strong SSL configuration and integrates reCAPTCHA for form security. Analytics are implemented via Adobe Analytics, Google Analytics, and LinkedIn Insight Tag, indicating a mature digital marketing and data collection strategy. From a security perspective, the website demonstrates good practices such as HTTPS enforcement, use of reCAPTCHA, and cookie consent mechanisms. However, some security headers like Content-Security-Policy and X-Frame-Options are not detected and could be added to enhance security. No critical vulnerabilities or exposed sensitive data were found. Overall, the website is trustworthy, compliant with privacy regulations including GDPR, and reflects a mature business with strong digital presence. The domain WHOIS data aligns with the company's identity and history, supporting legitimacy. Strategic recommendations include enhancing security headers, publishing a dedicated security policy, and adding a vulnerability disclosure mechanism to further strengthen security posture.

70
63
5
85
-
85
100
jQueryAdobe Dynamic MediaCoveo SearchGoogle Tag Manager+3

Partner Domains:

market.cardinalhealth.com
service
ir.cardinalhealth.com
service

+2 more partners

2025-06-21T18:21:54.970Z
corelab.com favicon

Core Lab

corelab.com

51
EnergyUnited StateslargeMEDIUM

Core Laboratories operates as a leading global provider of proprietary reservoir description and production enhancement services primarily serving the oil and gas industry. With a presence in over 70 offices across more than 50 countries, the company offers specialized laboratory and field services that enable clients to optimize reservoir performance and maximize hydrocarbon recovery. Their service portfolio includes advanced diagnostics, AI-driven data analysis, and carbon capture subsurface characterization, positioning them as a key player in energy sector innovation. Technically, the website is built on a modern WordPress CMS platform utilizing a variety of plugins and frameworks such as Elementor, Visual Composer, and GeneratePress. The infrastructure is hosted on WPEngine, ensuring reliable performance and scalability. The site demonstrates good mobile optimization, SEO practices, and accessibility features, supported by comprehensive metadata and structured data for enhanced search engine visibility. From a security perspective, the site enforces HTTPS with strong SSL configuration and implements several security headers. Client portals incorporate two-factor authentication, and cookie consent mechanisms are in place, reflecting a mature security posture. No critical vulnerabilities or exposed sensitive data were detected, though explicit security policies and vulnerability disclosure mechanisms could be improved. Overall, the website reflects a professional, trustworthy, and technically sound digital presence aligned with the company's market position. Strategic recommendations include enhancing security transparency, expanding incident response contact information, and further improving accessibility compliance to maintain leadership in digital maturity.

15
58
5
55
-
85
100
energyreservoiroilandgasproductionenhancementcarboncapture+3 more
WordPressPHPjQueryGoogle Analytics+14
2025-06-21T18:21:54.964Z
maltalingua.com favicon

Maltalingua Ltd.

maltalingua.com

37
EducationMaltamediumHIGH

Maltalingua Ltd. operates a well-established English language school in Malta, offering a range of courses for adults, juniors, and families. The school is internationally accredited and recognized with multiple awards, positioning it as a leading education provider in the Maltese market. Their services include language courses, accommodation arrangements, and cultural activities, targeting students worldwide seeking English language education in a Mediterranean setting. Technically, the website is built on Drupal 9, leveraging modern web technologies such as jQuery, Owl Carousel, and lazy loading for images. The site is mobile-optimized and provides a good user experience with clear navigation and professional design. Integration with Google Tag Manager and Tawk.to live chat indicates a moderate level of digital maturity and customer engagement. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks certain security headers and a formal security policy or incident response information, which are areas for improvement. Privacy compliance is partial, with a privacy policy present but no visible cookie consent mechanism, which may pose GDPR compliance risks. Overall, Maltalingua presents a credible and professional online presence with strong business credibility and good technical implementation. Strategic enhancements in privacy compliance and security practices would further strengthen their security posture and regulatory adherence.

60
10
-
70
-
75
-
educationlanguageschoolenglishcoursesmaltaeaquals+1 more
Drupal 9jQueryFont AwesomeGoogle Tag Manager+4
2025-06-21T18:21:54.962Z
B

BuyDomains.com

gonetworks.com

52
E-commerceUnited StateslargeMEDIUM

BuyDomains.com operates as a premium domain marketplace offering domain sales, brokerage, and lead capture services. The website targets businesses and individuals seeking memorable and brandable domain names, positioning itself as a trusted and established player in the domain sales industry. The platform integrates multiple marketing and analytics tools, including Google Analytics, Eloqua, and Google Tag Manager, to optimize user engagement and conversion tracking. Technically, the site is built on AngularJS 1.8.2, leveraging modern web technologies such as service workers for offline capabilities and Google reCAPTCHA for bot mitigation. The integration of Genesys chat enhances customer support capabilities. The website demonstrates good mobile optimization and basic accessibility features, with a moderate performance profile. From a security perspective, the site enforces HTTPS and employs a Content-Security-Policy, although the policy permits 'unsafe-inline' and 'unsafe-eval' scripts, which could be improved. The use of reCAPTCHA and secure form handling indicates a focus on preventing automated abuse. However, explicit security policies and incident response information are not present. Overall, the website presents a professional and trustworthy front with comprehensive privacy and cookie policies, GDPR compliance mechanisms, and clear contact information. The domain registration data aligns with the business claims, supporting legitimacy. Strategic recommendations include tightening security headers, adding vulnerability disclosure information, and enhancing accessibility.

55
60
-
50
-
65
100
premiumdomainbuydomaindomainmarketplaceleadcapturerecaptcha+3 more
AngularJS 1.8.2Google reCAPTCHA v2 & v3Google Tag ManagerEloqua+2

Partner Domains:

buydomains.com
parent
newfold.com
parent

+3 more partners

2025-06-21T18:21:54.759Z
blevinsfranks.com favicon

Blevins Franks

blevinsfranks.com

50
FinanceUnited KingdomlargeMEDIUM

Blevins Franks is a well-established financial advisory firm specializing in cross-border tax, wealth management, pensions, investments, and estate planning services primarily targeting British expatriates living in Europe. With over 50 years of experience and multiple offices across Europe and the UK, the company holds a strong market position as a leading adviser for UK nationals abroad. Their business model focuses on personalized financial planning and advisory services, supported by a comprehensive digital presence and strong regulatory compliance across jurisdictions including the UK, Malta, and France. Technically, the website is built on a modern WordPress CMS platform with WooCommerce integration, leveraging popular libraries such as jQuery and FontAwesome. It employs Google Analytics, Facebook Pixel, and Google Tag Manager for marketing and analytics purposes, alongside a cookie consent management system to ensure GDPR compliance. The site demonstrates good mobile optimization, SEO practices, and user experience design, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS and uses standard WordPress security practices, though explicit security headers are not clearly detected and could be improved. No critical vulnerabilities or exposed sensitive data were found. Privacy compliance is strong with clear privacy and cookie policies, and contact information is readily available. However, the absence of an incident response contact or vulnerability disclosure policy suggests room for enhancement in security transparency. Overall, Blevins Franks presents a trustworthy, professional, and compliant online presence with a solid business foundation. Strategic recommendations include enhancing security headers, publishing incident response and vulnerability disclosure information, and further improving accessibility features to maintain high standards in security and compliance.

35
33
5
60
-
80
100
financetaxplanningwealthmanagementexpatriatescross-border+3 more
WordPress 6.8.1WooCommerce 9.8.5jQuery 3.7.1FontAwesome 5.15.3+4
2025-06-21T18:21:54.747Z
gaminginnovationgroup.com favicon

GiG Software PLC

gaminginnovationgroup.com

65
TechnologyMaltalargeMEDIUM

GiG Software PLC is a leading technology provider specializing in iGaming platform and sportsbook solutions, serving a broad range of regulated markets globally. Their business model focuses on delivering scalable, multi-jurisdictional platform technology combined with AI-driven solutions and managed services to optimize operator performance and player engagement. The company holds reputable licenses from the Malta Gaming Authority and the UK Gambling Commission, reinforcing its market position and regulatory compliance. Technically, the website is built on WordPress with modern SEO and analytics integrations including Yoast SEO, Google Tag Manager, FullStory, and LinkedIn Insight. The site demonstrates good mobile optimization and user experience, with comprehensive cookie consent mechanisms and privacy policies aligned with GDPR requirements. The technical stack is mature but could benefit from updating legacy analytics scripts and enhancing security headers. From a security perspective, the site enforces HTTPS and employs best practices such as external link security attributes and cookie consent. However, explicit security and incident response policies are not publicly detailed, representing an area for improvement. No critical vulnerabilities or blocking mechanisms were detected, indicating a solid security posture. Overall, GiG Software PLC presents a trustworthy and professional online presence with strong business credibility and compliance. Strategic recommendations include enhancing security header implementation, publishing detailed security policies, and modernizing analytics tools to maintain leadership in the competitive iGaming technology sector.

75
55
43
85
-
80
100
igamingsportsbookplatformaisolutionsmanagedservices+3 more
WordPress CMSYoast SEO pluginjQueryGoogle Tag Manager+4

Partner Domains:

igamingcloud.com
subsidiary
betsson.com
partner

+3 more partners

2025-06-21T18:21:54.711Z
mga.org.mt favicon

Malta Gaming Authority

mga.org.mt

52
GovernmentMaltamediumMEDIUM

The Malta Gaming Authority (MGA) is a government regulatory body responsible for overseeing licensed gaming operations in Malta. The website clearly communicates the MGA's mission to ensure fairness, transparency, crime prevention, and protection of minors and vulnerable players. The MGA holds a strong market position as the national gaming regulator, providing key services such as licensee registration, enforcement actions, and player support. The target audience includes players, licensees, and industry stakeholders. The business model is regulatory and compliance-focused, with a medium-sized organizational footprint. Technically, the MGA website is built on WordPress and leverages modern web technologies including jQuery, Font Awesome, and integrations with Mailchimp for newsletter subscriptions. The site is hosted behind Cloudflare, providing CDN and security benefits. Performance is moderate with good mobile optimization and accessibility features. SEO is well implemented with proper meta tags and structured data. From a security perspective, the site enforces HTTPS and uses Cloudflare for protection. No critical vulnerabilities or exposed sensitive data were detected. However, security headers are not explicitly present, and there is no published security policy or incident response contact information. Privacy compliance is good with a comprehensive privacy policy, but lacks a cookie consent mechanism. The site uses tracking tools such as Google Tag Manager and Hotjar with moderate user tracking. Overall, the MGA website demonstrates a strong security posture and professional digital presence suitable for a government regulatory authority. Strategic recommendations include adding security headers, implementing cookie consent, publishing security policies, and considering a vulnerability disclosure program to further enhance trust and compliance.

70
3
5
75
-
80
100
gamingregulationmaltagovernmentcompliance+1 more
jQueryFont Awesome 6MailchimpGoogle Tag Manager+2
2025-06-21T18:21:54.671Z
kidstart.co.uk favicon

KidStart Limited

kidstart.co.uk

54
FinanceUnited KingdommediumMEDIUM

KidStart Limited operates a UK-based cashback platform designed to help families save money for their children by earning cashback on everyday online purchases from a wide range of partner retailers. The website is well-branded and targets parents, grandparents, and family members interested in building savings for children. The business model leverages affiliate partnerships with major retailers and financial services, including a Junior ISA offering. The site demonstrates a solid market position with visible trust indicators such as FCA authorization and customer testimonials. Technically, the website uses a traditional tech stack including jQuery, Font Awesome, Facebook SDK, and Google Analytics. While the site is mobile-optimized and has good SEO practices, some technical debt is evident with the use of an older jQuery version and lack of modern security headers. Performance is moderate, and accessibility is basic but functional. From a security perspective, the site enforces HTTPS and integrates secure Facebook OAuth login flows. However, it lacks explicit security headers and uses an outdated JavaScript library version, which could expose it to vulnerabilities. Privacy compliance is strong with clear privacy and cookie policies and GDPR indicators. No direct contact emails or phone numbers are provided on the main pages, which may affect user trust slightly. Overall, KidStart presents a trustworthy and professional online presence with a good balance of business credibility and privacy compliance. Security posture is adequate but could be improved by updating libraries and adding security headers. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic improvements in security and contact transparency would enhance trust and resilience.

55
43
-
85
-
70
100
cashbackchildrensavingsfamilyfinanceshoppinguk+2 more
jQuery 1.10.1Font AwesomeFacebook SDKGoogle Analytics+2

Partner Domains:

beanstalkapp.co.uk
partner
smart.link
partner
2025-06-21T18:21:54.663Z
seges.dk favicon

SEGES Innovation P/S

seges.dk

61
OtherDenmarklargeMEDIUM

SEGES Innovation P/S is a well-established independent research and innovation organization focused on sustainable agriculture and food production in Denmark. The company offers a broad range of services including research and development, digital solutions, specialist consulting, and educational events. Their market position is strong within the Danish agricultural sector, supported by a professional and content-rich website that targets agricultural professionals and stakeholders interested in sustainability and innovation. Technically, the website employs modern technologies such as ASP.NET Core, Google Tag Manager, and AWS hosting. It features a comprehensive cookie consent mechanism and integrates multiple third-party services for analytics and marketing. The site is mobile-optimized, accessible, and SEO-friendly, reflecting a mature digital infrastructure. From a security perspective, the site uses HTTPS and implements cookie consent best practices. However, it lacks some advanced security headers and explicit security policies. No critical vulnerabilities or exposed sensitive data were detected, indicating a solid security posture. Overall, the website demonstrates high professionalism, trustworthiness, and compliance with GDPR. The domain registration data aligns well with the business identity, reinforcing legitimacy. Strategic recommendations include enhancing security headers, publishing security policies, and adding a vulnerability disclosure mechanism to further strengthen security and compliance.

85
58
5
87
-
65
100
agricultureinnovationsustainabilityresearchfoodproduction+3 more
JavaScriptGoogle Tag ManagerGoogle AnalyticsCookie Information Consent Management+2

Partner Domains:

segesinnovation.com
related
cookieinformation.com
partner

+2 more partners

2025-06-21T18:21:54.640Z
exponaut.me favicon

Exponaut Ltd.

exponaut.me

65
TechnologyEstoniasmallMEDIUM

Exponaut Ltd. operates a specialized B2B event networking and engagement platform designed for expos, trade fairs, and large events. Their core offering includes AI-powered matchmaking, digital expo platforms, and comprehensive event management tools that facilitate seamless integration of physical and virtual event experiences. The company targets event organizers, trade show managers, and associations seeking to enhance attendee engagement and generate new revenue streams. Their market position is that of a niche technology provider with a focus on innovative event solutions leveraging AI and digital transformation. Technically, the website is built on a modern React and Next.js stack, optimized for performance and mobile responsiveness. It integrates third-party analytics and user behavior tracking tools such as Google Analytics, Google Tag Manager, and Hotjar, indicating a mature digital infrastructure. The platform supports iOS and Android apps, enhancing accessibility and user engagement across devices. From a security perspective, the site enforces HTTPS and includes standard security headers, demonstrating good baseline security hygiene. However, it lacks visible cookie consent mechanisms and published security or incident response policies, which are important for GDPR compliance and user trust. No critical vulnerabilities or exposed sensitive data were detected in the HTML content. Overall, Exponaut presents a credible and professional online presence with strong business and technical foundations. To further enhance trust and compliance, the company should implement explicit cookie consent, publish security policies, and consider adding a vulnerability disclosure program. These steps will improve privacy compliance and security posture, supporting sustainable growth and customer confidence.

30
53
25
80
74
75
100
eventmanagementmatchmakingnetworkingtradefairsdigitalexpo+2 more
ReactNext.jsJavaScriptSwiper.js+2

Partner Domains:

aimcongress.com
partner
2025-06-21T15:31:41.007Z