Skip to main content

High-risk security reports

Browse 46,997 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157365
Websites
130
Industries
113
Countries
52
Avg Score
Page 52 of 940|Showing 2551-2600 of 46997
derryaddpalletsltd.co.uk favicon

Derryadd Pallets Ltd

derryaddpalletsltd.co.uk

41
ManufacturingUnited KingdommediumHIGH

Derryadd Pallets Ltd is a Northern Ireland-based manufacturer and distributor of wooden pallets and timber packaging products, serving the UK and Ireland markets. With over 30 years of industry experience, the company specializes in both new and reconditioned wooden pallets, emphasizing sustainability and recycling. Their client base spans multiple sectors including retail, engineering, food production, pharmaceuticals, and agriculture. The website reflects a professional business with clear service offerings and industry memberships, such as the National Association of Pallet Distributors and Palletlink, enhancing their market credibility. Technically, the website employs a modern front-end stack including Bootstrap, jQuery, and various UI libraries, delivering a responsive and user-friendly experience. However, there is a lack of visible security headers and privacy compliance documentation, which are areas for improvement. The absence of WHOIS data due to domain registration issues raises concerns about domain legitimacy, although the website content itself is professional and business-focused. Security posture is moderate with no evident vulnerabilities in the HTML content, but the lack of security headers and privacy policies reduces the overall security and compliance score. No forms or tracking scripts were detected, indicating minimal data collection and user tracking. Overall, the website is functional and credible from a business perspective but requires enhancements in security and privacy compliance to align with best practices. Strategically, the company should address domain registration inconsistencies, implement comprehensive privacy and cookie policies, and enhance security headers to improve trust and compliance. These steps will strengthen their digital presence and reduce potential risks associated with domain legitimacy and regulatory compliance.

70
65
20
47
15
35
2
woodenpalletsreconditionedpalletsnewwoodenpalletstimberpackagingnorthernireland+3 more
BootstrapjQueryFont AwesomeOwl Carousel+3
2026-07-03T07:11:36.021Z
skulteskokmateriali.lv favicon

Skultes Kokmateriāli

skulteskokmateriali.lv

42
RetailLatviasmallHIGH

Skultes Kokmateriāli is a small Latvian business specializing in the retail and delivery of quality wood materials sourced from local forests. Their product range includes sawn timber, terrace boards, facade and interior finishing materials, screw piles, fences, and firewood, with delivery services across Latvia. The company targets general consumers and builders in the Limbažu novads region, positioning itself as a reliable local supplier with a professional online presence. The website is well-designed, mobile-optimized, and provides clear product information and pricing, enhancing user experience and trust. Technically, the website is built using modern technologies such as Next.js and React, hosted on Vercel, ensuring fast performance and good SEO practices. The site includes Vercel Analytics for minimal user tracking. However, there is a lack of visible security headers and no disclosed privacy or cookie policies, which are areas for improvement in compliance and security posture. From a security perspective, the site uses HTTPS with a good SSL configuration and does not expose sensitive data or vulnerable libraries. The absence of security headers and formal privacy documentation reduces the overall security maturity. No WAF or blocking mechanisms were detected, and the WHOIS data, while privacy-protected, aligns with the business's Latvian location and nature. Overall, the website presents a trustworthy and professional image suitable for its business scope but should enhance privacy compliance and security headers to improve its security posture and regulatory adherence.

40
60
60
15
10
17
57
woodmaterialsbuildingmaterialslatviaretaillocalbusiness+2 more
Next.jsReactVercel Analytics
2026-07-02T15:46:02.578Z
swallowsnursery.co.uk favicon

Swallows Nursery & Plant Centre Ltd

swallowsnursery.co.uk

49
RetailUnited KingdomsmallHIGH

Swallows Nursery & Plant Centre Ltd operates an independent retail plant nursery located in Mixbury, North Oxfordshire, UK. The company specializes in growing and selling high-quality plants, including shrubs, bedding plants, trees, and topiary, with an emphasis on peat-free products. Additionally, the business offers an onsite cafe serving coffee, Nordic cakes, brunch, and lunch on select days, enhancing the customer experience. The nursery also caters to trade buyers and provides delivery services. The website reflects a small, locally focused business with a strong community presence and a commitment to quality and sustainability. Technically, the website is built on WordPress using WooCommerce for e-commerce capabilities, WPBakery Page Builder for layout, and integrates several modern libraries such as Bootstrap 5 and jQuery. The site is mobile-optimized and includes SEO best practices like meta tags and structured data. However, some technical improvements are recommended, including the implementation of security headers and a cookie consent mechanism to enhance privacy compliance. From a security perspective, the site enforces HTTPS and uses secure forms with anti-spam measures. No critical vulnerabilities or exposed sensitive data were detected. The absence of security headers and incomplete analytics setup slightly reduce the security posture. The WHOIS data for the domain is unavailable or invalid, which raises concerns about domain registration legitimacy, though the presence of a UK company registration number and consistent business information on the site supports its legitimacy. Overall, the website presents a professional and trustworthy front for a small retail nursery business. Strategic recommendations include improving privacy compliance with cookie consent, adding security headers, clarifying WHOIS/domain registration status, and enhancing analytics implementation to support business growth and security assurance.

27
100
70
65
2
15
35
plantnurserygardeningretailcafeuk+2 more
WordPressWooCommerceWPBakery Page BuilderBootstrap 5+4
2026-07-02T07:24:04.611Z
T

The Marsh Agency

marsh-agency.co.uk

47
MediaUnited KingdomsmallHIGH

The Marsh Agency is a UK-based literary agency established in 1997, offering international representation services to writers, literary agents, and publishing companies. The website reflects a professional and consistent brand presence targeting literary professionals and publishing industry stakeholders. The business model centers on representation and rights management, positioning the agency as an established player in the media sector with a small company size. Technically, the website is built on WordPress with Bootstrap and jQuery frameworks, hosted by Zen Internet Limited. It employs Google Analytics and Tag Manager for user tracking and marketing insights. The site is moderately performant with good mobile optimization and basic accessibility features. SEO practices appear adequate with proper meta tags and structured navigation. From a security perspective, the site uses HTTPS with good SSL configuration but lacks explicit security headers such as CSP or HSTS. Forms include basic anti-spam measures but no visible cookie consent or privacy compliance mechanisms beyond a privacy policy page. No incident response or security policy information is published, indicating room for improvement in security transparency and GDPR compliance. Overall, the website is trustworthy and professionally maintained, with a solid business credibility score. However, enhancements in privacy compliance, security headers, and incident response disclosures would strengthen the security posture and regulatory adherence.

70
20
80
57
53
15
2
literaryagencypublishingwritersrepresentationinternationalrepresentationmedia
jQueryBootstrapGoogle AnalyticsGoogle Tag Manager+2
2026-07-02T07:21:38.943Z
nortonpeskett.co.uk favicon

Norton Peskett Solicitors

nortonpeskett.co.uk

48
OtherUnited KingdommediumHIGH

Norton Peskett Solicitors is a well-established law firm based in East Anglia, UK, with a history dating back to the 1830s. The firm offers a comprehensive range of legal services to both individuals and businesses, including criminal defence, family law, employment law, residential and commercial property, injury claims, mediation, and wills and probate. With multiple branch offices and over 120 experienced employees, Norton Peskett holds a strong regional market position supported by numerous accreditations and client testimonials. The website reflects a professional and trustworthy business with clear contact information and a user-friendly design. Technically, the website is built on WordPress 7.0 with modern SEO and analytics tools such as Yoast SEO, Google Analytics, Google Tag Manager, and Hotjar. It employs HTTPS with good SSL configuration and uses Google reCAPTCHA to secure forms. Cookie consent mechanisms and a privacy policy indicate GDPR compliance. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contact is published. From a security perspective, the site demonstrates good practices including HTTPS enforcement, anti-phishing warnings, and form protection. The absence of WHOIS data is unusual but likely due to querying the subdomain 'www' rather than the root domain. Despite this, the business legitimacy is supported by consistent branding, accreditations, and detailed contact information. Overall, the site scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility. Recommendations include implementing comprehensive security headers, publishing a security policy and incident response contacts, and adding a security.txt file to facilitate vulnerability disclosures. These steps would enhance the security posture and trustworthiness further.

65
20
60
47
53
15
17
lawfirmsolicitorslegalserviceseastangliafamilylaw+5 more
WordPress 7.0Yoast SEO pluginGoogle AnalyticsGoogle Tag Manager+3

Partner Domains:

www.eastmediation.co.uk
partner
unity.online
partner
2026-07-02T07:19:51.531Z
kingstonrecruitment.co.uk favicon

Kingston Recruitment Ltd

kingstonrecruitment.co.uk

46
OtherUnited KingdomsmallHIGH

Kingston Recruitment Ltd is a well-established recruitment agency based in Hull, East Yorkshire, specializing in office and commercial recruitment services including temporary, contract, and permanent placements. Founded in 1985, the company serves both candidates and clients with a strong regional presence and a reputation for quality service. The website reflects a professional business model focused on staffing solutions for a variety of sectors. Technically, the website employs a modern frontend stack including Bootstrap, jQuery, Owl Carousel, and integrates live chat via Tawk.to and analytics through Google Analytics and Tag Manager. The site is mobile optimized and provides a good user experience with clear navigation and relevant content. Security posture is moderate; HTTPS is implied but no security headers were detected in the provided data, and no explicit security or incident response policies are published. Privacy compliance is basic with a privacy policy present but lacking cookie consent mechanisms. WHOIS data could not be retrieved due to domain naming issues, which raises concerns about domain registration consistency but does not directly impact the legitimacy of the business as presented on the site. Overall, the website is professional and trustworthy but would benefit from enhanced security and privacy practices.

70
65
20
57
15
17
53
recruitmentjobsemploymenthulleastyorkshire+3 more
jQueryBootstrapOwl CarouselPrettyPhoto+2
2026-07-02T07:18:08.585Z