Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

151304
Websites
130
Industries
113
Countries
52
Avg Score
Page 358 of 1034|Showing 17851-17900 of 51662
sgfmuseum.org favicon

Springfield Art Museum

sgfmuseum.org

59
GovernmentUnited StatesmediumMEDIUM

The Springfield Art Museum website serves as the official online presence for a government-affiliated non-profit art museum located in Springfield, Missouri. The site provides information about exhibitions, classes, public programs, and museum expansion updates, targeting the general public and local community members interested in art and cultural activities. The business model is primarily government-supported with public engagement and donation facilitation. The website is moderately mature, having been established in 2013, and maintains consistent branding and trust indicators appropriate for a public institution. Technically, the website is built on the CivicPlus CMS platform and employs common web technologies such as jQuery, AlpineJS, Google Tag Manager, and Facebook Pixel for analytics and marketing. The site is mobile-optimized and accessible, with moderate performance. However, there is room for improvement in SEO and security configurations, particularly in enabling DNSSEC and implementing security headers. From a security perspective, the site uses HTTPS and anti-forgery tokens in forms, but lacks visible security headers and DNSSEC, which are recommended for enhanced protection. Privacy compliance is basic, with no explicit cookie consent mechanism or comprehensive privacy policy, which may pose compliance risks under GDPR. The domain registration is consistent and trustworthy, with no privacy protection, aligning with the public nature of the institution. Overall, the website is professional and trustworthy but would benefit from enhanced privacy and security measures to improve compliance and user trust.

40
35
2
60
72
85
100
museumarteducationgovernmentnon-profit+2 more
jQuery 2.2.4jQuery UI 1.14.1AlpineJS 3.14.1Google Tag Manager+3
2025-10-12T13:16:24.784Z
travefy.com favicon

Travefy, Inc.

travefy.com

73
HospitalityUnited StatesmediumMEDIUM

Travefy, Inc. is a well-established travel software company founded in 2012, specializing in providing integrated SaaS solutions for travel agents, agencies, tour operators, and related hospitality sectors. Their platform consolidates itinerary management, proposals, CRM, and marketing tools into a unified system designed to streamline travel business operations and enhance client engagement. With over 30,000 travel brands worldwide using their services, Travefy holds a strong market position supported by extensive supplier integrations and a dedicated support team. Technically, the website is built on modern web technologies including Webflow CMS, HubSpot, Mixpanel, and Google Tag Manager, hosted on AWS infrastructure. The site demonstrates excellent performance, mobile optimization, and SEO practices. Security is robust with HTTPS enforced, PCI-DSS compliance, and multiple security headers implemented. However, DNSSEC is not enabled, and there is no public security.txt or explicit incident response contact information. The security posture is strong with no detected vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms and GDPR compliance indicators. Business credibility is high, supported by consistent branding, customer testimonials, and trust signals such as PCI-DSS certification. Overall, Travefy presents a professional, secure, and user-friendly digital presence with a mature technical infrastructure and strong business legitimacy. Strategic recommendations include enabling DNSSEC, publishing a security.txt file, and enhancing transparency around incident response to further strengthen security and trust.

55
68
17
87
77
90
100
travelsoftwaretravelagentscrmitinerary+2 more
Webflow CMSHubSpot AnalyticsMixpanelGoogle Tag Manager+3
2025-10-12T13:15:44.461Z
T

Travel Insured International

travelinsured.com

70
OtherN/amediumMEDIUM

Travel Insured International operates as a travel insurance provider offering plans that cover trip cancellation, baggage, and medical emergencies. The company targets travelers seeking reliable insurance coverage to protect their trips. The website presents a professional and consistent brand image with clear service offerings and a focus on travel insurance solutions. The market position appears established within the travel insurance sector, although domain registration data is missing, which raises questions about domain legitimacy. Technically, the website leverages a modern technology stack including jQuery, Bootstrap, and Sitefinity CMS, alongside multiple third-party analytics and marketing tools such as Google Tag Manager, Facebook Pixel, and Microsoft Clarity. The site is mobile-optimized and demonstrates good SEO practices, although accessibility features are basic. Performance is moderate, with room for optimization. From a security perspective, the website lacks visible security headers and explicit privacy or cookie policies in the provided content, which impacts its security posture and privacy compliance. No WAF or blocking mechanisms are detected, and the site is accessible. The absence of WHOIS registration data is a critical concern for domain trustworthiness, although the website content and structure suggest a legitimate business operation. Overall, the site scores moderately on AI evaluation, with strengths in content quality and technical implementation but weaknesses in security and privacy compliance. Strategic improvements in domain registration transparency, security headers, and privacy policies are recommended to enhance trust and compliance.

65
53
55
80
65
80
100
travelinsuranceinsurancetravelmedicalcoveragebaggagecoverage+1 more
jQuery 3.6.4jQuery UI 1.11.3Bootstrap 5.1.3Bluebird Promise+8
2025-10-12T13:15:03.975Z
collette.com favicon

Collette: Vacations, Guided Tour Operator, Travel Packages

collette.com

71
HospitalityUnited StateslargeMEDIUM

Collette is a well-established guided tour operator based in the United States, offering a wide range of curated travel packages and vacation tours globally. The company targets travelers seeking immersive and feature-rich guided travel experiences, including small group explorations, cruising, faith-based journeys, and private tours. Their market position is strong, supported by extensive content, customer reviews, and active social media engagement. Technically, the website employs a modern technology stack including Bootstrap, FontAwesome, Swiper JS, and integrates multiple analytics and marketing tools such as HubSpot, Datadog RUM, Google Tag Manager, and Microsoft Clarity. The site is mobile-optimized, accessible, and SEO-friendly, providing a professional user experience. From a security perspective, the website enforces HTTPS and uses secure practices such as masked user input and Google reCAPTCHA. However, it lacks some security headers like Content-Security-Policy and X-Content-Type-Options, and does not publicly disclose security policies or incident response procedures. The WHOIS data for the domain is missing, which raises concerns about domain registration transparency and reduces trustworthiness despite the professional site presentation. Overall, the website is secure, professional, and compliant with privacy regulations, but the absence of WHOIS data and explicit security policies suggests areas for improvement in transparency and security posture.

65
80
2
80
72
85
100
travelguidedtoursvacationstouroperatorhospitality+1 more
Bootstrap 5FontAwesome 6.1.1Swiper JSVanilla LazyLoad+9
2025-10-12T13:14:33.078Z
pheedloop.com favicon

PheedLoop

pheedloop.com

77
TechnologyCanadamediumLOW

PheedLoop is a well-established Canadian technology company specializing in comprehensive event, community, and learning management software. Their platform supports hybrid, virtual, and on-site events with a broad suite of features including registration, mobile apps, streaming, badges, exhibitor and sponsor management, and learning accreditation. The company targets a diverse audience including corporations, associations, government entities, educational institutions, and non-profits. With over 10 years of market presence, PheedLoop positions itself as a mature SaaS provider in the event management industry. Technically, the website is built on Webflow CMS and leverages a modern technology stack including Google Analytics, Facebook Pixel, Microsoft Clarity, and other marketing and analytics tools. Hosting is provided via Amazon AWS infrastructure, ensuring reliable performance and scalability. The site is mobile-optimized with excellent design quality and user experience, reflecting a high level of digital maturity. From a security perspective, the site enforces HTTPS and uses reputable third-party services. However, there are areas for improvement such as enabling DNSSEC, implementing a Content-Security-Policy header, and publishing explicit security and incident response policies. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms, aligning with GDPR requirements. Overall, PheedLoop demonstrates a strong business credibility and trustworthy online presence. The domain registration data supports legitimacy, and the website content is professional and safe for general audiences. Strategic recommendations include enhancing DNS security, formalizing security policies, and improving transparency around vulnerability disclosures to further strengthen trust and security posture.

60
100
47
70
77
75
100
eventmanagementvirtualeventshybrideventscommunitymanagementlearningmanagement+2 more
Webflow CMSGoogle AnalyticsGoogle Tag ManagerFacebook Pixel+6
2025-10-12T13:13:41.924Z
sopilot.net favicon

SoPilot

sopilot.net

61
TechnologyN/asmallMEDIUM

SoPilot is a newly established AI-powered social media marketing assistant platform launched in 2025. It offers a suite of AI-driven tools designed to help marketers and content creators automate content generation, audience engagement, SEO backlink building, and multi-platform social media marketing. The platform positions itself as a cost-effective alternative to multiple standalone marketing tools, providing a comprehensive solution for social media growth and digital marketing automation. The website is professionally designed with clear navigation, responsive layout, and detailed service descriptions, targeting small to medium-sized marketing professionals and creators. Technically, SoPilot leverages modern web technologies including React and Next.js, hosted and registered via Cloudflare, ensuring fast performance and robust infrastructure. The site integrates Google Adsense and Google Tag Manager for advertising and analytics, indicating moderate user tracking. Security best practices such as HTTPS enforcement and security headers are implemented, though DNSSEC is not enabled and no explicit cookie consent mechanism is present, which are areas for improvement. From a security perspective, the site shows a good baseline posture with no visible vulnerabilities or exposed sensitive data. However, the absence of published security policies, incident response contacts, and GDPR compliance indicators suggests limited transparency in security governance. The WHOIS data aligns well with the business claims, showing a consistent and legitimate domain registration. Overall, SoPilot presents a credible and professional digital marketing SaaS offering with solid technical foundations and good user trust signals. Strategic enhancements in privacy compliance and security transparency would further strengthen its market position and user confidence.

15
65
17
55
75
80
100
aisocialmediamarketingdigitalmarketingseosaas+1 more
ReactNext.jsCloudflare DNS and registrarGoogle Adsense+1
2025-10-12T13:13:01.321Z
toolfame.com favicon

Hyhor

toolfame.com

62
TechnologyN/asmallMEDIUM

ToolFame.com is a curated online directory platform that helps users discover a wide range of online tools while providing founders a platform to showcase their products. The website targets users looking for productivity, marketing, development, design, and AI tools, positioning itself as a niche directory in the technology sector. The business model revolves around curated listings and referral traffic, with a small company size and a recent founding year of 2025 based on domain data. Technically, the site is built on modern web technologies including Next.js and React, with Cloudflare DNS and analytics integrations such as Google Tag Manager and Umami. The website demonstrates good design quality, mobile optimization, and SEO practices, but lacks comprehensive privacy and cookie policies, contact information, and security headers. Security posture is moderate with HTTPS enabled but missing DNSSEC and security headers. The WHOIS data shows inconsistencies, notably a future domain creation date and a registrant organization that does not clearly match the website branding, which lowers trustworthiness. Overall, the site is safe for general audiences and provides valuable content but requires improvements in privacy compliance, security practices, and transparency to enhance business credibility and user trust.

35
58
17
60
75
80
100
tooldirectoryonlinetoolstechnologyaitoolsproductivity+3 more
Next.jsReactCloudflare DNSGoogle Tag Manager+1

Partner Domains:

toolzack.com
partner
nuxtpro.com
partner

+2 more partners

2025-10-12T13:12:56.309Z
bodyby.ai favicon

Digital DNA Labs Inc.

bodyby.ai

64
HealthcareN/asmallMEDIUM

BodyBy.AI is a technology-driven healthcare company offering a personalized AI-powered fitness, nutrition, and wellness mobile application. The app provides adaptive workouts, goal-based meal plans, habit coaching, and real-time progress tracking, targeting a broad audience from beginners to advanced fitness enthusiasts. Positioned as a cost-effective alternative to traditional personal trainers, BodyBy.AI leverages AI to deliver customized daily plans that evolve with the user. The company is powered by Digital DNA Labs Inc., with a strong media presence and customer testimonials supporting its market credibility. Technically, the website is built on Webflow CMS with modern JavaScript libraries including Swiper.js for carousels and Vimeo for video hosting. It integrates Google Tag Manager and Facebook Pixel for analytics and marketing. The site is mobile-optimized, fast-loading, and accessible, with comprehensive SEO and metadata implementation. Privacy and terms of service pages are present, though a cookie consent mechanism is absent despite tracking scripts. Security posture is good with HTTPS enforced and no exposed sensitive data, but lacks visible security headers and a vulnerability disclosure policy. WHOIS data is unavailable due to privacy protection, which is typical for tech startups but limits transparency. Overall, the site demonstrates a mature digital presence with room for improvement in privacy compliance and security transparency. Risk assessment indicates a low risk profile with no critical vulnerabilities detected. Strategic recommendations include implementing cookie consent, adding security headers, publishing a vulnerability disclosure policy, and enhancing contact transparency to further build user trust and compliance.

30
53
25
70
72
80
100
aifitnessnutritionwellnesshealth+4 more
Webflow CMSGoogle Tag ManagerGoogle Analytics (gtag.js)Facebook Pixel+4

Partner Domains:

www.digitaldnalabs.ai
partner
2025-10-12T13:11:55.597Z
promotron.com favicon

PromoTron Solutions S.A.

promotron.com

61
TechnologyCzech RepublicmediumMEDIUM

PromoTron Solutions S.A. is a Czech Republic-based company specializing in cloud-based SaaS software solutions tailored for the promotional products industry. Their platform serves distributors, importers, manufacturers, and printing houses by digitizing sales processes, automating communication, and enhancing data exchange. With a market presence since 2017 and over 500 customers across 28+ countries, PromoTron offers multiple products including TronShop, TronManager, TronLogo, and TronCalculator, positioning itself as a key player in promotional industry digitalization. Technically, the website employs modern web technologies such as Bootstrap, jQuery, and various analytics and tracking tools including Google Analytics, Facebook Pixel, and LinkedIn Insight Tag. The site is mobile-optimized with good SEO and accessibility features, though some security headers are not explicitly detected. Privacy compliance is well addressed with a comprehensive privacy policy and cookie consent mechanism. Security posture is solid with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. However, the absence of security headers and lack of published security policies or incident response contacts suggest room for improvement. The WHOIS data is unavailable, which slightly reduces trust but is mitigated by strong business indicators and customer testimonials. Overall, PromoTron presents a professional, trustworthy, and technically competent online presence with a clear focus on the promotional industry SaaS market. Strategic enhancements in security transparency and WHOIS data availability would further strengthen their credibility and risk profile.

15
80
2
60
67
80
100
softwarepromotionalbusinessonline3ddesigningpromotionalproductssaas+2 more
jQueryBootstrap 4.1.2FancyBox 3Slick Carousel+6
2025-10-12T13:11:05.042Z
ayn8n.com favicon

AY Automate

ayn8n.com

68
TechnologyN/asmallMEDIUM

AY Automate operates the AY N8N website, an AI-powered workflow library and automation hub focused on n8n workflows. The platform offers over 10,000 free workflows with AI-driven recommendations, targeting users interested in automating business processes such as email, CRM, social media, and data processing. The website positions itself as a community-driven resource with intelligent search and filtering capabilities, catering to a niche market of automation enthusiasts and professionals. Technically, the website is built using modern web technologies including React and Next.js, hosted likely on Vercel, and integrates analytics tools such as Vercel Analytics and Google Tag Manager. The site demonstrates excellent design quality, mobile optimization, and SEO practices, providing a smooth user experience with clear navigation and rich content. From a security perspective, the site uses HTTPS and secure forms but lacks explicit security headers and formal privacy or cookie policies. No WHOIS data is available for the domain, which raises concerns about domain registration legitimacy and age. No contact or incident response information is provided, limiting transparency in security and compliance matters. Overall, AY N8N presents a professional and valuable resource for workflow automation but should improve transparency around privacy, security policies, and domain registration to enhance trust and compliance.

85
68
2
60
72
75
100
n8nworkflowsautomationaiworkflowlibrarybusinessautomation+4 more
ReactNext.jsVercel AnalyticsLucide Icons+2

Partner Domains:

ayautomate.com
partner
2025-10-12T13:11:00.033Z
C

CaseTutor

casetutor.com

60
EducationN/asmallMEDIUM

CaseTutor is a specialized AI-powered platform focused on preparing consulting candidates for case interviews at top firms such as McKinsey, BCG, and Bain. The platform offers realistic, industry-specific case simulations, real-time voice transcription, personalized feedback, and progress tracking. It targets aspiring and existing consultants, providing tiered subscription plans including coaching and résumé review. The website is professionally designed, mobile-optimized, and features strong trust signals including user testimonials and aggregate ratings. Technically, CaseTutor leverages modern web technologies including Next.js and React, with integration of Google Tag Manager for analytics. The site demonstrates good SEO and accessibility practices, though performance is moderate. Security posture is solid with HTTPS enforced, but lacks some security headers and published security policies. Privacy compliance is partial, with a privacy policy present but no visible cookie consent mechanism. The WHOIS data for the domain is missing or unavailable, which raises concerns about domain legitimacy and registration transparency. Despite this, the professional presentation and detailed structured data suggest a legitimate business. Overall, the site scores well on content quality and technical implementation but should improve privacy compliance and security headers to enhance trust and compliance.

30
53
17
60
72
70
100
caseinterviewconsultingprepai-powerededucationconsulting+1 more
ReactNext.jsJavaScriptGoogle Tag Manager
2025-10-12T13:10:50.001Z
Q

QuickImg

quickimg.org

63
TechnologyN/asmallMEDIUM

QuickImg is a newly established AI-driven platform specializing in image generation, enhancement, and editing using multiple advanced AI models. It targets creative professionals, marketers, e-commerce businesses, and content creators by providing an all-in-one solution that simplifies complex image workflows. The platform offers a user-friendly interface with natural language input, ready-to-use templates, and one-click AI tools, positioning itself as a comprehensive and accessible AI image service in the technology sector. Technically, QuickImg is built on a modern Next.js framework with React, hosted likely behind Cloudflare DNS services, and integrates payment processing via Stripe. The website demonstrates excellent performance, mobile optimization, and SEO practices, reflecting a mature digital infrastructure for a recently launched service. Analytics are implemented through Google Tag Manager, indicating moderate user tracking. From a security perspective, the site enforces HTTPS and has domain transfer protections in place. However, DNSSEC is not enabled, and explicit security headers or incident response policies are not publicly documented. Privacy compliance is partially addressed with clear privacy and cookie policies, though no active cookie consent mechanism is detected. Contact information is limited to email support, with no phone or physical address provided. Overall, QuickImg presents a professional, trustworthy, and technically sound platform with minor gaps in security transparency and privacy mechanisms. Strategic improvements in security policy publication and cookie consent would enhance compliance and user trust.

20
68
17
70
75
70
100
aiimagegenerationimageeditingtechnologycreativetools+1 more
ReactNext.jsCloudflare DNSStripe (payment processing)+1

Partner Domains:

stripe.com
partner
2025-10-12T13:10:29.618Z
cmmc-roi.com favicon

BomberJacket Networks

cmmc-roi.com

69
GovernmentUnited StatesmediumMEDIUM

BomberJacket Networks is a specialized cybersecurity consulting firm focused on helping defense contractors achieve CMMC compliance to secure Department of Defense contracts. The company positions itself as an authorized C3PAO with over 20 years of cybersecurity experience and a strong emphasis on service-disabled veteran ownership. Their website features a sophisticated CMMC ROI calculator tool designed to help organizations understand the financial impact and investment required for compliance. The business targets small to large defense contractors and technology firms with tailored compliance solutions and ongoing support services. Technically, the website is built on modern frameworks including React and Next.js, hosted on Vercel, and incorporates Google Tag Manager for analytics. The site is well-optimized for performance, mobile responsiveness, and SEO, with clear navigation and professional design. Security posture is solid with HTTPS enforced and no visible vulnerabilities, though some security headers are missing and no explicit cookie consent mechanism is present. From a security and compliance perspective, the site demonstrates strong trust signals through certifications, partnerships, and detailed service offerings. However, the absence of WHOIS registration data for the domain introduces some uncertainty about domain legitimacy. No explicit incident response or vulnerability disclosure policies are published, which could be improved to enhance trust and compliance. Overall, BomberJacket Networks presents a credible and professional front for CMMC compliance consulting, with a strong technical foundation and business focus. Addressing minor security and privacy gaps and clarifying domain registration details would further strengthen their market position and trustworthiness.

30
53
67
70
72
75
100
cmmcroicalculatordodcontractscybersecuritycompliance+3 more
ReactNext.jsGoogle Tag ManagerRecharts (charting library)

Partner Domains:

bomberjacket.net
partner
portal.bomberjacket.net
service
2025-10-12T13:10:24.608Z
U

United States Office of Personnel Management

usajobs.gov

77
GovernmentUnited StatesenterpriseLOW

USAJOBS is the official employment website of the United States federal government, operated under the United States Office of Personnel Management. It serves as the primary portal for job seekers to find and apply for federal government positions across a wide range of career fields. The platform offers comprehensive services including job search, resume management, application submission, and career exploration tools tailored to veterans, students, federal employees, and the general public. The website is well-branded, consistent, and highly professional, reflecting its authoritative government status. Technically, USAJOBS employs modern web technologies such as HTMX for dynamic content, Google Tag Manager for analytics, and uses secure HTTPS connections with optimized performance and excellent mobile responsiveness. Accessibility features are well implemented, ensuring compliance with government standards. The site integrates multiple official government domains and resources, enhancing its ecosystem and user experience. From a security perspective, USAJOBS demonstrates a strong posture with enforced HTTPS, secure form handling, session management, and no visible vulnerabilities or exposed sensitive data. However, explicit security headers and a visible cookie consent mechanism could be improved. Privacy policies and terms of service are comprehensive and clearly linked, supporting regulatory compliance including GDPR. WHOIS data is limited due to privacy typical of government domains but does not detract from the site's legitimacy. Overall, USAJOBS is a highly credible, secure, and user-friendly government employment portal with strong trust indicators and a robust technical foundation. Strategic recommendations include enhancing visible security headers, implementing cookie consent, and publishing security incident response information to further strengthen trust and compliance.

75
53
47
100
75
80
100
governmentjobsfederalemploymentcareerusajobs+2 more
JavaScriptHTMXGoogle Tag ManagerUniversal-Federated-Analytics+1

Partner Domains:

www.opm.gov
partner
careers.bop.gov
partner

+1 more partners

2025-10-12T13:09:44.342Z
U

U.S. Social Security Administration

socialsecurity.gov

69
GovernmentUnited StatesenterpriseMEDIUM

The website www.ssa.gov is the official online presence of the U.S. Social Security Administration, a federal government agency responsible for administering Social Security programs including retirement, disability, and Medicare benefits. The site offers a comprehensive range of services such as benefits estimation, application processing, status checking, and card replacement, targeting U.S. residents and citizens. It maintains a strong market position as the authoritative source for Social Security information and services. Technically, the site is built on Drupal 10 CMS and leverages modern web technologies including Google Tag Manager, New Relic for performance monitoring, and Boomerang for real user monitoring. The site demonstrates excellent mobile optimization, accessibility, and SEO practices, ensuring a high-quality user experience. Hosting details are not explicitly stated but are consistent with government hosting standards. From a security perspective, the site enforces HTTPS, uses security monitoring tools, and likely implements standard security headers, although explicit header details are not visible in the provided data. No vulnerabilities or exposed sensitive data were detected. Privacy and cookie policies are clearly presented, with GDPR compliance indicators, reflecting a mature privacy posture. Overall, the site scores highly on content quality, technical implementation, security posture, privacy compliance, and business credibility. The domain is a .gov domain, which is tightly controlled and indicative of legitimacy. WHOIS data is privacy protected as expected for government domains. There are no signs of malicious activity or suspicious content. Strategic recommendations include publishing explicit security headers, incident response contacts, and vulnerability disclosure information to further enhance trust and transparency.

30
58
17
70
100
85
100
governmentsocialsecuritybenefitsmedicaredisability+3 more
Drupal 10Google Tag ManagerNew Relic Browser MonitoringBOOMR (Boomerang) performance monitoring+2
2025-10-12T13:09:34.178Z
mymoney.gov favicon

Financial Literacy and Education Commission (FLEC)

mymoney.gov

71
GovernmentUnited StateslargeMEDIUM

MyMoney.gov is an official U.S. government website managed by the Financial Literacy and Education Commission (FLEC) under the U.S. Department of the Treasury. It provides comprehensive financial literacy resources, tools, and educational materials targeted at a broad audience including youth, educators, researchers, military families, and federal payment recipients. The site serves as a trusted source for financial empowerment and education, supporting informed financial decision-making across the United States. Technically, the website is built on Drupal 10 CMS and leverages modern web technologies including FontAwesome for icons, Google Analytics and Google Tag Manager for analytics, and Akamai Boomerang for performance monitoring. The site is mobile-optimized, accessible, and uses HTTPS with strong SSL configuration, ensuring secure and reliable user experience. From a security perspective, the site enforces HTTPS and anonymizes IP addresses in analytics, but lacks some advanced security headers and a cookie consent mechanism. No vulnerabilities or exposed sensitive data were detected. WHOIS data is incomplete, which is typical for government domains, but the .gov TLD and official branding strongly support legitimacy. Overall, the site demonstrates a strong security posture appropriate for a government informational resource. The overall risk is low, with recommendations to enhance privacy compliance by implementing cookie consent and publishing a vulnerability disclosure policy. Adding explicit security headers would further strengthen the security posture. The site is professionally designed, trustworthy, and serves an essential public service role.

55
58
25
70
95
80
100
financialliteracygovernmenteducationustreasuryfinancialempowerment+2 more
Drupal 10FontAwesomeGoogle AnalyticsGoogle Tag Manager+2
2025-10-12T13:09:23.755Z
cdfifund.gov favicon

Community Development Financial Institutions Fund

cdfifund.gov

67
GovernmentUnited StatesmediumMEDIUM

The Community Development Financial Institutions Fund (CDFI Fund) is a U.S. government entity under the Department of the Treasury focused on fostering economic growth in distressed communities by supporting mission-driven financial institutions. The website serves as a comprehensive portal for information on certification, funding programs, training, awards, and research data related to community development finance. It targets financial institutions, community organizations, and stakeholders seeking to engage with or benefit from CDFI programs. Technically, the website is built on Drupal 10, leveraging modern analytics and performance monitoring tools such as Google Analytics, Google Tag Manager, and Boomerang. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Hosting appears to be government-managed with Akamai CDN integration, ensuring reliable performance. From a security perspective, the site enforces HTTPS and employs anonymized IP tracking in analytics. While explicit security headers are not fully confirmed, no vulnerabilities or exposed sensitive data were detected. The absence of a cookie consent mechanism and published incident response policy are areas for improvement. The WHOIS data is limited due to the .gov domain nature but aligns with the official government status, supporting high legitimacy. Overall, the site presents a professional, trustworthy, and well-maintained digital presence for the CDFI Fund, with recommendations to enhance privacy compliance and security transparency to further strengthen user trust and regulatory adherence.

55
58
2
70
85
80
100
governmentfinancecommunitydevelopmentcdfitraining+3 more
Drupal 10Google AnalyticsGoogle Tag ManagerYouTube iframe API+2
2025-10-12T13:09:08.669Z
treasurydirect.gov favicon

U.S. Department of the Treasury

treasurydirect.gov

71
GovernmentUnited StatesenterpriseMEDIUM

TreasuryDirect.gov is the official U.S. Department of the Treasury website providing electronic services for purchasing, managing, and redeeming U.S. Savings Bonds and other Treasury securities. It serves a broad audience including the general public, financial professionals, and government entities. The platform is the sole official channel for these financial instruments, positioning it as a critical government financial service with a strong market presence. The website offers comprehensive information, tools, and auction data to support users in managing their investments securely and efficiently. Technically, the site employs a modern technology stack including jQuery, Bootstrap, Google reCAPTCHA, and Google Tag Manager, ensuring a responsive and accessible user experience. The site is well-optimized for mobile devices and includes accessibility features. Hosting appears to be managed by or for the U.S. government, ensuring reliability and compliance with government standards. From a security perspective, TreasuryDirect.gov demonstrates a strong posture with enforced HTTPS, use of security headers, and bot protection mechanisms. No vulnerabilities or exposed sensitive data were detected. However, there is room for improvement in publishing explicit security policies, vulnerability disclosure programs, and cookie consent mechanisms to enhance compliance and transparency. Overall, TreasuryDirect.gov is a highly trustworthy, professional, and secure government website that effectively serves its mission. Strategic enhancements in privacy compliance and security transparency would further strengthen its position and user trust.

70
53
2
70
100
85
100
governmentfinancetreasurysavingsbondsmarketablesecurities+1 more
jQueryBootstrapGoogle reCAPTCHAGoogle Tag Manager+2

Partner Domains:

fedinvest.fiscal.treasury.gov
partner
slgsafe.fiscal.treasury.gov
partner

+3 more partners

2025-10-12T13:09:03.656Z
sigpr.gov favicon

U.S. Department of the Treasury

sigpr.gov

69
GovernmentUnited StatesenterpriseMEDIUM

The U.S. Department of the Treasury's website at home.treasury.gov is a comprehensive and authoritative government portal focused on providing services and information related to reporting fraud, waste, and abuse. It serves a broad audience including the general public, businesses, financial institutions, and government entities. The site offers multiple reporting options, consumer alerts, and links to inspector general hotlines, positioning itself as a primary resource for fraud-related concerns within the U.S. Treasury domain. Technically, the website is built on Drupal 10 and leverages modern web technologies including Google Analytics, Google Tag Manager, and the U.S. Web Design System (USWDS) for accessibility and responsive design. The site demonstrates good performance, excellent mobile optimization, and strong accessibility features, ensuring a positive user experience across devices. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes standard security headers. There are no visible vulnerabilities or exposed sensitive data. However, the site lacks an explicit cookie consent mechanism and a published terms of service page, which are areas for improvement in privacy compliance. The WHOIS data is restricted as expected for a government .gov domain, with no suspicious indicators, supporting the site's legitimacy. Overall, the website is a high-quality, trustworthy government resource with strong business credibility and technical implementation. Strategic recommendations include enhancing privacy compliance with cookie consent, publishing terms of service, and providing clear incident response contacts to further strengthen trust and security posture.

55
58
17
70
85
80
100
governmentfraudfraudreportingustreasuryscams+2 more
Drupal 10Google AnalyticsGoogle Tag ManagerFontAwesome+1

Partner Domains:

oig.treasury.gov
partner
www.irs.gov
partner

+2 more partners

2025-10-12T13:08:58.646Z
treas.gov favicon

U.S. Department of the Treasury

treas.gov

69
GovernmentUnited StatesenterpriseMEDIUM

The U.S. Department of the Treasury website serves as the official digital presence of the federal agency responsible for managing the nation's finances, economic policy, and financial security. It provides a broad range of services and information targeting the general public, businesses, financial institutions, and government entities. The site is well-branded, professionally designed, and offers comprehensive content including policy issues, data centers, services, and news updates. Technically, the website is built on Drupal 10 with integration of modern web technologies such as Google Analytics, Google Tag Manager, and the U.S. Web Design System (USWDS). It is hosted likely behind Akamai's CDN and performance monitoring tools, ensuring fast load times and good mobile responsiveness. Accessibility and SEO best practices are well implemented. From a security perspective, the site enforces HTTPS and uses secure analytics configurations. However, explicit security headers are not clearly visible in the HTML, and there is no publicly available security policy or incident response contact information. The absence of a cookie consent mechanism and vulnerability disclosure page are minor compliance gaps. Overall, the security posture is strong but could be improved with more transparency and user privacy controls. The domain WHOIS data is unavailable, which is typical for U.S. government domains that restrict public WHOIS information for security reasons. The domain is a subdomain of treasury.gov, confirming its legitimacy. No suspicious or malicious indicators were found. The website is safe for general audiences and does not contain any adult or questionable content.

55
58
17
70
85
80
100
governmentfinancetreasuryofficialdata+2 more
Drupal 10Google AnalyticsGoogle Tag ManagerFontAwesome+2

Partner Domains:

treasury.gov
parent
treasurydirect.gov
partner

+1 more partners

2025-10-12T13:08:43.541Z
fincen.gov favicon

Financial Crimes Enforcement Network

fincen.gov

68
GovernmentUnited StateslargeMEDIUM

The Financial Crimes Enforcement Network (FinCEN) operates as a bureau within the United States Department of the Treasury, focusing on safeguarding the financial system from illicit activities such as money laundering and terrorist financing. It provides critical financial intelligence, regulatory guidance, and enforcement actions to financial institutions, law enforcement, and government agencies. The website serves as a comprehensive resource hub for these stakeholders, offering access to advisories, reporting requirements, and enforcement updates. The site’s market position is that of a key federal government entity with authoritative oversight in financial crime prevention. Technically, the website is built on Drupal 10, leveraging modern web technologies including Google Tag Manager, Akamai mPulse for performance monitoring, and Font Awesome for iconography. The site is well-optimized for mobile and accessibility standards, with fast loading times and clear navigation. Security best practices are observed with HTTPS enforcement and no visible vulnerabilities or exposed sensitive data. Analytics usage is moderate and privacy policies are comprehensive, though a cookie consent mechanism is not explicitly present. From a security perspective, the site demonstrates a strong posture with secure configurations and adherence to government standards. The WHOIS data is limited due to privacy protections typical for government domains, but the domain’s .gov TLD and consistent branding strongly support legitimacy. No critical vulnerabilities or suspicious patterns were detected. Overall, the site is trustworthy, professional, and well-maintained. The overall risk assessment is low, with recommendations to enhance transparency by publishing explicit security headers and implementing a visible cookie consent banner to improve privacy compliance. Strategic improvements in incident response disclosures and security policy visibility would further strengthen trust and compliance.

50
58
20
70
95
65
100
governmentfinancefinancialcrimesamllawenforcement+3 more
Drupal 10Google Tag ManagerFont Awesome 6Universal-Federated-Analytics+1
2025-10-12T13:08:38.531Z
bep.gov favicon

Bureau of Engraving and Printing

bep.gov

72
GovernmentUnited StateslargeMEDIUM

The Bureau of Engraving and Printing (BEP) is a U.S. government agency responsible for the production of United States currency and related services such as mutilated currency redemption and currency accessibility programs. The website serves as an official portal providing educational resources, public services, and access to currency-related products. It targets the general public, government entities, and visually impaired individuals, positioning itself as the authoritative source for currency production information. Technically, the website is built on Drupal 10, leveraging modern web standards and government design systems (USWDS). It integrates Google Analytics and Tag Manager for analytics while maintaining privacy through IP anonymization. The site is mobile-optimized, accessible, and well-structured, reflecting a mature digital infrastructure. From a security perspective, the site enforces HTTPS, uses official .gov domain credentials, and follows best practices in data protection. While explicit security headers are not fully visible in the HTML, the overall posture is strong with no exposed vulnerabilities or sensitive data. Privacy policies and vulnerability disclosure information are present, though incident response contacts could be more explicit. Overall, the website is trustworthy, professional, and compliant with government standards, providing a safe and informative experience. Strategic recommendations include enhancing security header implementation, adding explicit incident response contacts, and implementing a cookie consent mechanism to improve GDPR compliance.

55
58
35
70
85
80
100
governmentcurrencyengravingprintingustreasury+2 more
Drupal 10Google AnalyticsGoogle Tag ManagerUS Web Design System (USWDS)+1

Partner Domains:

www.ttb.gov
partner
www.fiscal.treasury.gov
partner

+3 more partners

2025-10-12T13:08:33.521Z
ttb.gov favicon

Alcohol and Tobacco Tax and Trade Bureau

ttb.gov

69
GovernmentUnited StatesenterpriseMEDIUM

The Alcohol and Tobacco Tax and Trade Bureau (TTB) is a federal government agency under the United States Department of the Treasury responsible for regulating and enforcing laws related to alcohol and tobacco products. The website serves as an authoritative source for regulatory information, licensing, tax collection, and trade practices enforcement. It targets businesses in the alcohol and tobacco industries, government entities, and the general public seeking compliance guidance. The site is well-branded, professionally designed, and provides comprehensive content relevant to its mission. Technically, the website is built on Drupal 10 CMS, leveraging modern web technologies including Akamai CDN for performance, Google Tag Manager, Microsoft Clarity, and DigitalGov Analytics for user behavior tracking and analytics. The site demonstrates excellent mobile optimization, accessibility, and SEO practices, ensuring a positive user experience across devices. From a security perspective, the site enforces HTTPS with strong SSL configuration and implements key security headers to protect users. However, it lacks a dedicated security policy page, incident response contacts, and a vulnerability disclosure program, which are recommended for enhancing transparency and security posture. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website is a trustworthy and authoritative government resource with a strong security baseline and good privacy compliance. Strategic improvements in security transparency and incident response readiness would further strengthen its posture.

55
58
17
70
85
80
100
governmentalcoholtobaccotaxtrade+2 more
Drupal 10Google Tag ManagerMicrosoft ClarityYouTube iframe API+2
2025-10-12T13:08:28.491Z
asta.org favicon

American Society of Travel Advisors

asta.org

69
HospitalityUnited StateslargeMEDIUM

The American Society of Travel Advisors (ASTA) operates a professional and comprehensive website serving as the leading global advocate for travel advisors. The site provides education, advocacy, resources, and networking opportunities to its members and the broader travel industry. The business model is membership-based, focusing on supporting travel advisors through events, certifications, and industry advocacy. The organization is well-established with a domain age of over 20 years, reinforcing its market position as a trusted industry leader. The website content is relevant, professionally presented, and targets travel professionals and consumers seeking travel advisory services. Technically, the website is built on ASP.NET Web Forms with Telerik UI components and uses ContentBuddy CMS. It integrates multiple analytics and marketing tools including Google Analytics, Google Tag Manager, Facebook Pixel, LinkedIn Insight Tag, and Microsoft Application Insights for telemetry. Hosting and DNS services are managed via Cloudflare, providing reliable infrastructure. The site demonstrates moderate performance and good mobile optimization, though accessibility features are basic. From a security perspective, the site enforces HTTPS and uses clientTransferProhibited domain status to prevent unauthorized transfers. However, DNSSEC is not enabled, and there is no visible Content Security Policy or security.txt file. Privacy compliance is weak due to the absence of explicit privacy and cookie policies or consent mechanisms. No incident response or vulnerability disclosure information is provided. Overall, the security posture is adequate but could be improved with enhanced DNS security and published policies. The overall risk assessment is moderate with no critical vulnerabilities detected. Strategic recommendations include enabling DNSSEC, publishing privacy and cookie policies with consent mechanisms, implementing a Content Security Policy, and providing clear security incident contacts. These improvements would enhance trust, compliance, and security maturity, supporting ASTA's reputation as a leading travel industry association.

70
88
17
75
42
80
100
traveladvocacyeducationmembershipevents+2 more
ASP.NET Web FormsTelerik UI controlsjQueryGoogle Tag Manager+4
2025-10-12T12:06:26.790Z
element.de favicon

element - Personalberatung für Finance & Banking, SAP, IT, Engineering und Healthcare

element.de

58
FinanceGermanysmallMEDIUM

Element GmbH is a specialized personal consulting firm focusing on recruitment services in Finance & Banking, SAP, IT, Engineering, and Healthcare sectors. The company targets both candidates and enterprises seeking specialized personnel solutions. Their market position is that of a niche player with a professional and consistent brand presence. The website is well-structured, multilingual, and provides clear contact channels and social media integration, reflecting a mature digital presence. Technically, the website is built on WordPress with modern plugins such as WP Job Manager, Search Filter Pro, and WPML for multilingual support. It uses Google Tag Manager and Cookiebot for analytics and privacy compliance, respectively. The hosting is managed via DomainControl.com, and the site is optimized for mobile devices with good SEO practices. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms aligned with GDPR. While explicit security headers are not fully confirmed, no vulnerabilities or exposed sensitive data were detected. The absence of a published security policy or incident response contact is noted as an area for improvement. Overall, the website presents a low-risk profile with strong privacy compliance and business credibility. Strategic recommendations include enhancing security header implementation, publishing security and incident response policies, and adding terms of service to improve transparency and trust.

15
83
17
85
90
70
20
personalberatungfinancebankingsapit+5 more
WordPress 6.8.3PHPjQuery 3.7.1Google Tag Manager+4
2025-10-12T12:06:11.760Z