Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 3 of 29|Showing 101-150 of 1438
gyn-onko-update.com favicon

med update GmbH

gyn-onko-update.com

51
HealthcareGermanysmallMEDIUM

The website gyn-onko-update.com represents a specialized medical education platform focused on gynecological oncology updates, organized by med update GmbH. It targets healthcare professionals, providing annual seminar events with expert presentations and clinical research reviews. The business model centers on event organization and professional education, supported by pharmaceutical sponsors and cooperation partners. The website is well-branded, professionally designed, and content-rich, serving a niche but important audience in the healthcare sector in Germany. Technically, the site is built on WordPress with a modern plugin ecosystem including SEO, analytics (Matomo), and GDPR compliance tools. It uses common web technologies such as jQuery and Slider Revolution for interactive content. Performance and mobile optimization are adequate, though accessibility features are basic. Hosting details are not explicit but DNS and registrar data indicate a stable setup. Security posture is good with HTTPS enforced and cookie consent mechanisms in place. However, no advanced security headers were detected, and no explicit security or incident response policies are published. No vulnerabilities or suspicious content were found. Privacy compliance is strong with clear policies and consent management. Overall, the site is trustworthy, professional, and well-maintained, with a low risk profile. Strategic improvements could include enhanced security headers, explicit security policies, and more direct contact information for incident response. These would further strengthen trust and compliance in a healthcare context.

20
100
2
40
67
75
20
healthcaremedicaleducationeventgynecologicaloncologyseminar+1 more
WordPressPHPjQuerySlider Revolution+5

Partner Domains:

med-update.com
partner
wikonect.de
partner

+3 more partners

2025-10-31T14:26:57.977Z
prointegris.hr favicon

Pro Integris

prointegris.hr

52
EnergyCroatiasmallMEDIUM

Pro Integris is a specialized engineering company established in 2007, focusing on power plants, substation automation, and renewable energy sectors. The company positions itself as a contributor to sustainable electrical engineering solutions, offering a range of services including design, relay protection, ICT, power facilities, training, and cyber security tools. Their market presence is supported by ISO certifications and EU financing, indicating a credible and quality-driven business model. Technically, the website is built on WordPress with modern plugins and themes, supporting multilingual content and GDPR compliance. The infrastructure is moderate in performance with good mobile optimization and SEO practices. Security posture is strong with HTTPS enforced and cookie consent implemented, though some security headers and explicit security policies are absent. Overall, the security posture is solid with no visible vulnerabilities or exposed sensitive data. The business credibility is high, supported by clear contact information, certifications, and professional content. Recommendations include enhancing security headers, publishing a security policy, and adding vulnerability disclosure mechanisms to further strengthen trust and compliance. The website content is safe for general audiences, with no adult or questionable content detected. The domain registration data aligns well with the business claims, reinforcing legitimacy and trustworthiness.

15
80
2
80
72
85
-
energyengineeringpowersystemsautomationrenewableenergy+3 more
WordPressPHPjQueryWPBakery Page Builder+4
2025-10-31T14:00:28.059Z
cambraterrassa.org favicon

Cambra de Comerç de Terrassa

cambraterrassa.org

10
GovernmentSpainmediumCRITICAL

Cambra de Comerç de Terrassa is a regional chamber of commerce focused on supporting economic development and business growth in the Terrassa region of Spain. The website presents a professional and consistent brand image, offering business support services and entrepreneurial development initiatives. The target audience primarily includes local businesses and entrepreneurs seeking economic development assistance. The business model revolves around providing services and support to foster regional economic growth. Technically, the website is built on WordPress using the Astra theme and Elementor page builder, supplemented by WooCommerce for e-commerce capabilities. It integrates several analytics and marketing tools including Matomo, Google Tag Manager, Hotjar, and LinkedIn Insight. The site is hosted by Entorno Digital, S.A., with a domain registered since 2005, indicating a mature and stable online presence. Performance and mobile optimization are good, with basic accessibility and SEO optimizations in place. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms, alongside a GDPR-compliant cookie consent mechanism. However, explicit security headers and a published security policy or incident response contact are absent, representing areas for improvement. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is basic, with no explicit privacy policy or terms of service found in the analyzed content. Overall, the website is trustworthy and professional, with a solid business credibility score. The main risks relate to the absence of explicit security policies and limited contact information. Strategic recommendations include enhancing security headers, publishing a security and privacy policy, and providing clear contact channels for security incidents to improve trust and compliance.

-
-
-
-
-
-
-
chamberofcommerceeconomicdevelopmentbusinesssupportregionalwordpress+3 more
WordPressAstra ThemeElementorWooCommerce+7
2025-10-31T12:21:14.531Z
velkopopovickakozlovna.cz favicon

Velkopopovická Kozlovna - restaurace Velké Popovice

velkopopovickakozlovna.cz

62
HospitalityCzech RepublicsmallMEDIUM

Velkopopovická Kozlovna is a traditional restaurant located in Velké Popovice, Czech Republic, closely associated with the world-famous Velkopopovice brewery. The business offers authentic dining experiences featuring tank and unfiltered Kozel beer, group menus, event catering, conference spaces, accommodation, and brewery tours. The website reflects a small hospitality business with a local market focus, emphasizing traditional Czech cuisine and beer culture. Technically, the site is built on WordPress using the Divi theme, incorporating modern web technologies such as Google reCAPTCHA and Google Analytics, and hosted by Active24 with CDN support. The site is moderately performant, mobile-optimized, and SEO-friendly, though accessibility features are basic. Security posture is good with HTTPS enforced and spam protection, but lacks explicit security headers and published security policies. Privacy compliance is partial, with a cookie consent banner present but no privacy policy or terms of service pages found. Overall, the domain registration data is consistent and trustworthy, supporting the legitimacy of the business. The content is safe for general audiences except for alcohol-related content, which is appropriate for the hospitality sector.

65
25
2
65
72
85
100
restauranthospitalitybeerczechrepublictraditional+4 more
WordPressDivi ThemejQueryGoogle reCAPTCHA v3+6
2025-10-31T11:53:37.986Z
regionalpark-rosengarten.de favicon

Regionalpark Rosengarten e.V.

regionalpark-rosengarten.de

48
GovernmentGermanysmallHIGH

Regionalpark Rosengarten e.V. is a small non-profit organization focused on promoting regional development and tourism in the northern part of the Lüneburger Heide near Hamburg, Germany. The website serves as an information hub for leisure activities, regional projects, and barrier-free tourism, targeting tourists, local visitors, and project stakeholders. The organization benefits from EU and regional funding, as indicated by logos and content references. Technically, the website is built on WordPress using modern plugins such as UberMenu, Maps Marker Pro, and Complianz GDPR for cookie management. The site is well-structured, mobile-optimized, and accessible, with good SEO practices and moderate performance. Hosting is provided by kasserver.com, as inferred from the nameservers. From a security perspective, the site enforces HTTPS and uses cookie consent mechanisms compliant with GDPR. However, it lacks explicit security headers and does not provide a public security policy or incident response contact. No vulnerabilities or exposed sensitive data were detected in the HTML content. The WHOIS data is minimal but consistent with the organization's profile, with no privacy protection or suspicious patterns. Overall, the website presents a professional, trustworthy, and compliant digital presence for a regional non-profit entity. Strategic recommendations include enhancing security headers, publishing a security policy, and maintaining plugin updates to ensure ongoing security and compliance.

15
95
2
70
72
45
-
regionalparktourismleaderregionaldevelopmentbarrier-free+4 more
WordPressjQueryUberMenuMaps Marker Pro+3
2025-10-31T11:34:22.204Z
baasch-steinburg.de favicon

Artur Baasch GmbH

baasch-steinburg.de

51
EnergyGermanysmallMEDIUM

Artur Baasch GmbH is a well-established regional Meisterbetrieb specializing in heating systems and bathroom renovation services in the Kreis Steinburg area of Germany. The company has a long history dating back to 1951 and offers a comprehensive range of services including new bathroom construction, 3D bathroom planning, heating installation, modernization, and maintenance. The website reflects a professional business model targeting residential and commercial customers seeking expert advice and quality workmanship. The presence of partner logos from reputable brands enhances trust and market positioning. Technically, the website is built on WordPress using Elementor and Yoast SEO, indicating a modern and maintainable infrastructure. The site is mobile-optimized and includes GDPR-compliant cookie consent mechanisms via the Complianz plugin. Google Analytics is used with IP anonymization, reflecting attention to privacy compliance. Hosting appears to be with a German provider, consistent with the business location. From a security perspective, the site uses HTTPS and has implemented cookie consent, but lacks visible security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The WHOIS data shows no privacy protection but lacks detailed registrant information, which is common for small businesses. Overall, the domain and website appear legitimate and consistent with the business claims. The overall risk assessment is low with recommendations to enhance security headers, add incident response information, and consider a vulnerability disclosure policy. The website quality is good with clear navigation, relevant content, and professional design, supporting business credibility and customer trust.

15
80
2
80
62
70
20
heatingbathroomrenovationsanitrheizungsbaubadsanierung+3 more
WordPress 6.8.3Elementor 3.32.5Elementor Pro 3.32.3Yoast SEO 26.2+3
2025-10-31T11:04:52.894Z
serapis-medical.de favicon

SERAPIS Medical GmbH

serapis-medical.de

61
HealthcareGermanysmallMEDIUM

SERAPIS Medical GmbH is a specialized healthcare transportation service provider based in Ludwigsburg, Germany. The company focuses on qualified patient transport, emergency medical support, and international patient repatriation. Their website reflects a professional and consistent brand image, targeting patients and healthcare providers who require reliable medical transport services. The business operates a small-scale model with a clear regional focus and offers key services such as ambulance service, regular patient transport, and medical repatriation with professional care. Technically, the website is built on a modern WordPress platform using Elementor and JupiterX theme, supported by plugins like Complianz for GDPR compliance. The site is mobile-optimized and performs moderately well, with good SEO and basic accessibility features. The technical infrastructure is sound, though some improvements in security headers and incident response documentation could enhance the security posture. Security-wise, the site enforces HTTPS and uses a cookie consent mechanism compliant with GDPR. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of explicit security policies, incident response contacts, and vulnerability disclosure mechanisms suggests room for improvement in security maturity. Overall, the website is trustworthy, professionally maintained, and compliant with privacy regulations. The risk level is low, but strategic enhancements in security policies and transparency would strengthen the company’s security and compliance posture further.

20
80
2
70
77
60
100
healthcarepatienttransportemergencymedicalservicesgdprwordpress+1 more
WordPress 6.8.3Elementor 3.28.3JupiterX themejQuery 3.7.1+2
2025-10-31T10:04:16.446Z
mum-lifeline.de favicon

M&M Lifeline

mum-lifeline.de

64
HealthcareGermanysmallMEDIUM

M&M Lifeline is a specialized provider of certified seminars and training programs primarily targeting healthcare professionals and nursing staff in Germany. Established in 2003, the company offers a variety of in-house, online, and presence seminars focusing on emergency response, first aid, and nursing-related topics. Their market position is supported by over 20 years of experience and certification by recognized bodies such as the MDK. The website reflects a professional and consistent brand image with clear navigation and relevant content tailored to their audience. Technically, the website is built on WordPress using modern plugins and frameworks such as Avia Framework and WPForms. It employs HTTPS with excellent SSL configuration and includes GDPR-compliant cookie consent mechanisms. Performance is moderate with good mobile optimization and basic accessibility features. Analytics are implemented via Jetpack Statistics, with moderate user tracking and good privacy compliance. From a security perspective, the site enforces HTTPS and uses cookie consent but lacks explicit security headers and a dedicated security policy or incident response information. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is consistent with the business claims, showing a domain age appropriate for the company's history and no privacy protection, enhancing trustworthiness. Overall, the website presents a low-risk profile with strong business credibility and compliance posture. Strategic improvements could focus on enhancing security headers, publishing a security policy, and improving accessibility to further strengthen the security and user experience.

20
95
17
70
67
60
100
healthcaretrainingseminarsfirstaidemergency+4 more
WordPressPHPjQueryAvia Framework+3

Partner Domains:

mum-lifeline.jobs.personio.de
partner
2025-10-31T10:04:06.423Z
zekaem.hr favicon

ZKM

zekaem.hr

10
OtherCroatiamediumCRITICAL

Zagrebačko kazalište mladih (ZKM) is a well-established cultural institution in Croatia focused on theatrical performances and educational programs. The website serves as a portal for event schedules, ticket sales, and news updates, targeting the general public interested in theater and culture. The organization maintains an active digital presence with social media integration and multilingual support via Google Translate. The domain age and WHOIS data confirm legitimacy and consistency with the business profile. Technically, the website is built on WordPress using popular plugins such as WPBakery Page Builder, Ultimate VC Addons, and GDPR compliance tools like Complianz. The site demonstrates good SEO practices, mobile optimization, and moderate performance. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, though some security headers could be improved. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website reflects a professional and trustworthy cultural institution with good privacy compliance and user experience. However, it lacks explicit security policies and incident response contacts, which could enhance trust and preparedness. The site uses Google Analytics and Facebook Pixel for analytics and marketing, with appropriate consent mechanisms. Strategic recommendations include enhancing security headers, publishing a security policy, and conducting regular security audits to maintain and improve the security posture.

-
-
-
-
-
-
-
theatercultureeventseducationcroatia+1 more
WordPressPHPjQueryGoogle Fonts+5
2025-10-31T09:28:49.895Z
obiteljski.hr favicon

Obiteljski centar

obiteljski.hr

48
GovernmentCroatiamediumHIGH

Obiteljski centar is a Croatian public institution dedicated to providing counseling services and programs aimed at children, youth, parents, and families. The organization operates with a mission to support personal growth, strengthen family relationships, and foster community engagement. Their services are offered free of charge, emphasizing accessibility and social welfare. The website reflects a well-established entity with a domain age consistent with its founding year of 2013. The content is professionally presented in Croatian, targeting local audiences in need of social and family support services. Technically, the website is built on WordPress using modern plugins such as Yoast SEO and WPBakery Page Builder, ensuring good SEO and user experience. The site is mobile optimized and includes cookie consent mechanisms compliant with GDPR, reflecting a mature digital infrastructure. While the hosting provider is not explicitly identified, the site uses HTTPS with a good SSL configuration, contributing to secure communications. From a security perspective, the site demonstrates good practices including HTTPS enforcement and cookie consent. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not detected and could be improved. No vulnerabilities or exposed sensitive data were found in the HTML content. The absence of a security policy or incident response page suggests room for enhancement in security transparency. Overall, the website presents a low-risk profile with strong compliance to privacy regulations and a clear focus on social services. Recommendations include implementing additional security headers, publishing security policies, and maintaining regular updates to WordPress and plugins to sustain security posture.

15
25
17
70
72
80
20
familysocialserviceseducationnon-profitcroatia+3 more
WordPressYoast SEOjQueryWPBakery Page Builder+4
2025-10-31T09:26:47.137Z
rdakademiebonn.de favicon

Rettungsdienst-Akademie Bonn

rdakademiebonn.de

46
HealthcareGermanysmallHIGH

Rettungsdienst-Akademie Bonn is a specialized educational institution based in Germany offering state-recognized training programs for emergency medical personnel including rescue helpers, paramedics, emergency paramedics, and emergency physicians. The website serves as a comprehensive platform for course information, scheduling, and contact, targeting individuals seeking professional certification in emergency medical services. The business operates in the healthcare and education sectors with a small organizational size and a founding year of 2021, aligning with the domain registration date. Technically, the website is built on WordPress using Elementor and several reputable plugins such as Yoast SEO and Complianz GDPR for SEO and privacy compliance. The site demonstrates good mobile optimization, clear navigation, and a professional design. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, although explicit security headers and incident response policies are not publicly documented. Overall, the website shows a mature digital presence with compliance to GDPR through privacy and cookie policies, social media integration, and structured data for SEO. No critical vulnerabilities or suspicious content were detected. The WHOIS data supports the legitimacy of the domain with consistent registration information and appropriate domain age. Strategic recommendations include enhancing security headers, publishing explicit security and incident response policies, and considering a vulnerability disclosure program to further strengthen trust and security posture.

15
80
2
50
72
70
-
healthcareeducationemergencyservicestraininggdpr+2 more
WordPressElementorYoast SEOjQuery+4
2025-10-31T06:04:21.746Z
waermewende-durch-geothermie.de favicon

Wärmewende durch Geothermie

waermewende-durch-geothermie.de

52
EnergyGermanymediumMEDIUM

The website 'Wärmewende durch Geothermie' represents a collaborative initiative of geothermal energy companies and municipal/private energy suppliers in Germany. It promotes the use of deep geothermal energy for district heating and green electricity production as a key solution for the country's CO2-neutral heating goals. Supported by industry partners and research institutes like Fraunhofer, the initiative targets municipalities, energy providers, government bodies, and the general public interested in sustainable energy solutions. The site features comprehensive content, partner logos, testimonials, and active social media engagement, reflecting a mature and professional business presence. Technically, the website is built on WordPress 6.8.3 with a modern tech stack including popular plugins such as Smart Slider 3, Contact Form 7, and Complianz GDPR for privacy compliance. The hosting is provided by rzone.de, and the site is well-optimized for mobile devices with good SEO practices. Performance is moderate, with no critical technical issues detected in the HTML content. From a security perspective, HTTPS is enforced, and cookie consent mechanisms are implemented, indicating good privacy compliance. However, security headers like Content-Security-Policy and HSTS are not evident in the HTML, suggesting room for improvement. No vulnerabilities or exposed sensitive data were found, but regular updates and security audits are recommended to maintain a strong security posture. Overall, the website scores well on content quality, technical implementation, privacy compliance, and business credibility, with an overall AI score of 81. There are no signs of WAF blocking or malicious content. Strategic recommendations include enhancing security headers, maintaining plugin updates, and adding a security.txt file for vulnerability disclosures to further strengthen trust and security.

15
80
17
65
67
70
20
energygeothermalrenewableenergygermanyenvironment+3 more
WordPress 6.8.3PHP (implied by WordPress)jQuery 3.7.1Smart Slider 3 plugin+6
2025-10-31T05:16:49.124Z