Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 18 of 656|Showing 851-900 of 32764
kbr.com favicon

KBR Inc.

kbr.com

75
TechnologyN/aenterpriseMEDIUM

KBR Inc. is a global provider of science, technology, and engineering solutions primarily serving governments and companies worldwide. The company positions itself as a trusted partner delivering innovative and sustainable technology-led solutions, with key service areas including Mission Technology Solutions, Sustainable Technology Solutions, and Digital Accelerators. The website reflects a mature enterprise-level business with consistent branding and professional content tailored to a B2B audience. Technically, the website is built on Drupal CMS and leverages modern web technologies such as Video.js for multimedia, Google Tag Manager and Analytics for tracking, and CookieYes for consent management. Accessibility is enhanced through the UserWay widget, and the site is mobile-optimized with good SEO practices. Performance is moderate, with some room for optimization. From a security perspective, the site enforces HTTPS and uses bot protection mechanisms like Google reCAPTCHA and Cloudflare Bot Management cookies. However, explicit security headers are not detected, and there is no publicly visible security policy or incident response information. The WHOIS data for the domain is unavailable, which slightly reduces transparency but does not detract from the site's legitimacy given the professional presentation and external references. Overall, the website demonstrates a strong security posture and privacy compliance with comprehensive cookie consent mechanisms and GDPR-aligned privacy policies. The business credibility is high, supported by clear corporate governance and investor relations information. Strategic recommendations include enhancing security headers, publishing a security policy, and providing explicit incident response contacts to further strengthen trust and compliance.

49
85
100
98
25
90
68
technologyengineeringgovernmentcorporateprivacy+2 more
Drupal CMSVideo.jsGoogle Tag ManagerGoogle Analytics+5

Partner Domains:

investors.kbr.com
partner
careers.kbr.com
partner

+1 more partners

2026-07-11T07:15:15.726Z
stannswarehouse.org favicon

St. Ann's Warehouse

stannswarehouse.org

58
OtherUnited StatesmediumMEDIUM

St. Ann's Warehouse is a well-established cultural arts organization based in Brooklyn, New York, specializing in theater productions and cultural events. The website reflects a medium-sized non-profit entity with a strong market position in the arts and culture sector. Their services include theater shows, membership programs, and facility rentals, targeting a general audience interested in performing arts. The domain has been registered since 2003, consistent with the organization's history and credibility. Technically, the website is built on WordPress with a modern tech stack including jQuery, Google Analytics, Facebook and TikTok pixels, and uses Cloudflare for DNS management. The site is mobile optimized and has good SEO practices, though performance is moderate. The presence of multiple marketing and tracking tools indicates a mature digital marketing approach but raises privacy compliance concerns. Security posture is adequate with HTTPS enabled and domain registration protections in place; however, the lack of DNSSEC, security headers, and published security policies indicates room for improvement. No critical vulnerabilities were detected, but privacy compliance is weak due to missing privacy and cookie policies. Overall, the website is professional and trustworthy but should enhance privacy compliance and security best practices to reduce risk and improve user trust.

32
75
80
100
65
35
2
theaterartsculturenon-profitevents+1 more
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+5
2026-07-11T07:13:02.388Z
uks.com favicon

Updike, Kelly & Spellacy, P.C.

uks.com

52
OtherUnited StatesmediumMEDIUM

Updike, Kelly & Spellacy, P.C. is a well-established Connecticut law firm with a strong regional presence and affiliations that extend its reach nationally and internationally. The firm offers a broad range of legal services including business and corporate law, litigation, real estate, technology, and governmental affairs. Their website reflects a professional and client-focused approach, targeting businesses and individuals seeking legal expertise in Connecticut and beyond. Technically, the website employs a modern technology stack including Bootstrap, jQuery, and Google Analytics, ensuring a responsive and user-friendly experience. While performance is moderate and mobile optimization is good, there is room for improvement in accessibility and security headers implementation. The site uses asynchronous loading for analytics and marketing scripts, indicating a focus on performance and tracking. From a security perspective, the site uses HTTPS and integrates standard analytics and marketing tools but lacks visible security headers and cookie consent mechanisms, which are important for compliance and protection. The absence of WHOIS data for the domain is a notable concern, potentially impacting trustworthiness. No explicit security policies or incident response contacts are provided, which could be improved to enhance transparency and readiness. Overall, the website is professional and credible but would benefit from enhanced privacy compliance, security best practices, and domain registration transparency to strengthen its security posture and user trust.

80
40
70
67
17
53
15
lawfirmconnecticutlegalservicesbusinesslawlitigation+1 more
jQuery 2.2.2Modernizr 2.8.3Bootstrap CSS and JSFont Awesome 4.3.0+5

Partner Domains:

meritas.org
partner
2026-07-11T07:09:48.267Z
lee-evans.co.uk favicon

Lee Evans Partnership LLP

lee-evans.co.uk

51
Real EstateUnited KingdomsmallMEDIUM

Lee Evans Partnership LLP is a UK-based award-winning architecture, planning, heritage, and interior design practice with offices in Canterbury and London. The company targets clients seeking professional architectural and planning services. Their website reflects a professional and consistent brand image with clear service offerings and a focus on quality design. The business appears to be a small-sized firm founded around 2016, with a solid market position in the real estate and design sector. Technically, the website is built on WordPress CMS using modern technologies such as jQuery, Bootstrap, Google Analytics, and Google Maps API. The site is mobile-optimized with good SEO practices and moderate performance. Security posture is good with HTTPS enforced and no visible vulnerabilities, though security headers and cookie consent mechanisms are lacking. The security posture is solid but could be improved by adding security headers, publishing security policies, and implementing GDPR-compliant cookie consent. The absence of WHOIS data due to an invalid query limits domain trust verification but the professional website and social media presence support legitimacy. Overall, the site is safe, professional, and trustworthy with room for privacy and security enhancements. Strategic recommendations include improving privacy compliance with cookie consent, adding security headers, publishing incident response contacts, and regular security audits to maintain trust and compliance.

60
70
100
27
53
2
15
architectureplanningheritageinteriorsprofessionalservices+1 more
jQueryBootstrapGoogle AnalyticsGoogle Maps API+2
2026-07-11T07:07:24.054Z
sepha.com favicon

SEPHA

sepha.com

65
ManufacturingUnited KingdommediumMEDIUM

SEPHA Ltd is a well-established UK-based manufacturer specializing in non-destructive leak testing, blister packing, and deblistering equipment primarily for the pharmaceutical and medical device industries. With over 40 years of industry experience and a strong reputation among leading pharmaceutical manufacturers, SEPHA offers a range of products and services including quality control solutions, packaging machinery, and contract packaging services. The website reflects a mature digital presence with professional design, clear navigation, and comprehensive content tailored to its B2B audience. Technically, the site is built on WordPress with integrations of HubSpot marketing tools, Google Analytics, and other modern web technologies, ensuring good SEO and mobile optimization. Security posture is solid with HTTPS and some security headers, though improvements such as enabling DNSSEC and adding a Content-Security-Policy header are recommended. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. Overall, SEPHA demonstrates strong business credibility and digital maturity, though it could enhance transparency by publishing explicit security policies and incident response information.

57
80
100
80
15
17
83
pharmaceuticalleaktestingblisterpackingmedicaldevicepackagingqualitycontrol+2 more
WordPressYoast SEOHubSpot FormsGoogle Tag Manager+5

Partner Domains:

tasigroup.com
partner
2026-07-10T07:23:42.501Z
adaptdesign.com favicon

Adapt Design and Advertising Limited

adaptdesign.com

45
OtherJerseysmallHIGH

Adapt Design and Advertising Limited is a small creative agency based in Jersey, Channel Islands, specializing in design, advertising, brand identity, print, and website development. Established in 1997, the company serves startups, large businesses, and marketing teams with a comprehensive suite of creative services. Their market position is strengthened by a long-standing local presence and referrals extending beyond Jersey. The website reflects a professional and consistent brand image with extensive service offerings and client testimonials, indicating a trustworthy and credible business. Technically, the website employs common industry tools such as Google Analytics, Google Tag Manager, jQuery, Owl Carousel, and Revolution Slider. The site is moderately performant with good mobile optimization and basic accessibility features. SEO practices are adequately implemented with proper meta tags and structured navigation. However, no CMS or hosting provider details are evident, and some modern security best practices like security headers are missing. From a security perspective, the website uses HTTPS (implied by external scripts loaded over HTTPS), but lacks visible security headers and explicit incident response or security policy information. The absence of WHOIS data for the domain raises concerns about domain legitimacy and registration transparency, which impacts trustworthiness. Privacy and cookie policies exist but lack active consent mechanisms, indicating partial GDPR compliance. Overall, the website presents a professional and content-rich experience with moderate technical maturity and some security gaps. The missing WHOIS data and limited security policies suggest areas for improvement to enhance trust and compliance. Strategic recommendations include implementing security headers, enforcing cookie consent, clarifying domain registration details, and enhancing incident response readiness.

75
20
37
70
2
68
15
designagencyadvertisingbrandingwebdevelopmentcreativeagency+2 more
Google AnalyticsGoogle Tag ManagerjQueryOwl Carousel+2
2026-07-10T07:20:36.987Z
C

CAMB Machine Knives International Limited

camb-knives.co.uk

46
ManufacturingUnited KingdomsmallHIGH

CAMB Machine Knives International Limited is a UK-based manufacturer specializing in high-quality machine knives with over 25 years of experience. The company serves a global industrial audience, exporting to over 20 countries and providing additional services such as regrinding and re-sharpening of blades. Their website reflects a professional business with a clear product range and international agent network, positioning them as an established player in the manufacturing sector. Technically, the website is built on the concrete5 CMS platform and employs common web technologies including jQuery and Google Analytics. While the site is functional and moderately optimized for mobile, it uses an older CMS version and lacks some modern security headers and accessibility features. Security posture is adequate with HTTPS enabled and no visible vulnerabilities, but the absence of a published security policy and incident response contact reduces transparency. The WHOIS data for the domain is unavailable and indicates the domain name is invalid under Nominet UK rules, which raises concerns about domain legitimacy despite the professional website presence. Overall, the site is safe, business-focused, and trustworthy in content but would benefit from improved privacy compliance and security transparency.

57
70
65
20
50
30
2
manufacturingmachineknivesindustrialbladesukexport+1 more
jQueryNivo SliderGoogle AnalyticsGoogle Translate+3
2026-07-10T07:19:54.332Z
biomap.co.uk favicon

Biomap Limited

biomap.co.uk

57
HealthcareUnited KingdomsmallMEDIUM

Biomap Limited is a specialized provider of temperature monitoring and mapping services tailored for the Life Sciences industry, including pharmaceutical manufacturing, distribution, and clinical environments. Established in 2009, the company has built a strong reputation with nearly two decades of experience and a client base that includes major pharmaceutical and healthcare organizations. Their offerings encompass both services such as temperature mapping, packaging qualification, calibration, and shipping studies, as well as products like continuous monitoring systems and data loggers sourced from reputable partners. The website reflects a professional and consistent brand image, targeting B2B clients in healthcare and life sciences sectors primarily within the UK. Technically, the website is built on WordPress with modern front-end libraries and integrates Google Analytics, Google Tag Manager, and reCAPTCHA for tracking and security. The site is mobile-optimized and SEO-friendly with structured data and Open Graph metadata. However, some security best practices such as security headers and cookie consent mechanisms are missing, which could be improved to enhance compliance and security posture. Security-wise, the site uses HTTPS and employs reCAPTCHA on forms, but lacks explicit security policies and incident response information. No vulnerabilities or suspicious content were detected. The domain registration data is consistent with the business claims, showing a long-standing presence and no privacy protection, which supports legitimacy. Overall, Biomap Limited presents a credible, professional online presence with good technical implementation and business credibility. Strategic improvements in security headers, privacy compliance (cookie consent), and incident response transparency would further strengthen their security posture and regulatory compliance.

47
65
100
70
15
17
58
temperaturemappinglifesciencespharmaceuticaltemperaturemonitoringcalibration+2 more
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+4

Partner Domains:

cryopak.com
partner
labcold.com
partner

+1 more partners

2026-07-10T07:18:38.136Z
T

TJ Williams Ltd

tjwilliams.co.uk

49
ManufacturingUnited KingdommediumHIGH

TJ Williams Ltd is a well-established UK-based manufacturer specializing in precision handcrafted pressure, level, and temperature instrumentation with over 150 years of industry presence. The company offers a comprehensive range of products including pressure gauges, calibration and repair services, bespoke designs, and acts as an official distributor for Kobold UK. Their market position is strong within the industrial manufacturing sector, targeting engineers and industrial clients requiring reliable instrumentation solutions. Technically, the website is built on a modern WordPress CMS with WooCommerce integration, leveraging Themify Ultra theme and jQuery libraries. The site is hosted via Cloudflare, ensuring good performance and security at the network level. Mobile optimization and SEO practices are well implemented, although accessibility features could be improved. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks several recommended security headers and a cookie consent mechanism, which impacts GDPR compliance. No explicit security policies or incident response contacts are published, indicating room for improvement in security transparency and readiness. Overall, the website is professional, trustworthy, and business-focused with a solid technical foundation. Strategic enhancements in privacy compliance and security best practices would further strengthen the company's digital maturity and customer trust.

57
20
70
65
20
17
58
pressuregaugesmanufacturingindustrialinstrumentationcalibrationrepair+2 more
WordPress 7.0WooCommerce 10.9.3jQueryThemify Ultra Theme+2

Partner Domains:

kobold.com
partner
2026-07-10T07:16:35.887Z
dalrod.co.uk favicon

DALROD

dalrod.co.uk

52
OtherUnited KingdommediumMEDIUM

DALROD UK Ltd is a professional drainage service provider offering expert 24/7 rapid response drainage solutions across the United Kingdom. Their services include drain cleaning, unblocking, repairs, CCTV surveys, liquid waste disposal, and emergency drainage services. The company positions itself as a trusted and accredited provider with over 35 years of experience, serving both residential and commercial customers nationwide. The website reflects a mature digital presence with comprehensive service descriptions, customer testimonials, and multiple industry certifications, indicating a strong market position. Technically, the website is built on WordPress using Elementor and Yoast SEO plugins, integrating modern analytics and marketing tools such as Google Analytics, Microsoft Clarity, and Trustist reviews. The site is mobile-optimized, accessible, and SEO-friendly, with a cookie consent mechanism in place to comply with privacy regulations. The technical infrastructure is solid, though some security headers could be improved to enhance security posture further. From a security perspective, the site enforces HTTPS and employs consent-based tracking, demonstrating good privacy compliance. No critical vulnerabilities or exposed sensitive data were detected. However, the WHOIS lookup for the subdomain 'www.dalrod.co.uk' failed due to a naming rules violation, likely because the query was made on the subdomain rather than the registered domain 'dalrod.co.uk'. This does not detract from the legitimacy of the business as evidenced by the website content and structured data. Overall, DALROD presents a trustworthy and professional online presence with strong business credibility and compliance. Strategic improvements in security headers and ongoing monitoring of third-party scripts are recommended to maintain and enhance security posture.

40
57
65
75
80
15
2
drainagedrainrepairdrainunblockingcctvdrainsurveysemergencyservices+3 more
WordPressElementorYoast SEOGoogle Tag Manager+3
2026-07-10T07:16:30.535Z
C

Car Concierge

carconciergeservice.co.uk

46
TransportationUnited KingdomsmallHIGH

Car Concierge, operating under the brand Abels Car Concierge Service, is a UK-based company specializing in premium vehicle storage, transportation, and shipping services. Established since at least 2010, the company holds a prestigious Royal Warrant, underscoring its reputation for quality and reliability. The website clearly targets vehicle owners seeking secure and professional car storage and transport solutions across the UK, Europe, and worldwide. The business model focuses on service provision with a strong emphasis on trust and heritage. Technically, the website is built on WordPress with a moderate technology stack including popular plugins for analytics, forms, and UI enhancements. The site is moderately optimized for performance and mobile use, with good SEO practices evident in metadata and structured data. However, accessibility and advanced mobile optimization are basic. Security posture is adequate with HTTPS enforced and no exposed sensitive data, but lacks advanced HTTP security headers and visible security policies. From a security and compliance perspective, the site does not display explicit privacy or cookie consent mechanisms, which may pose GDPR compliance risks. There is no published incident response or vulnerability disclosure information. The domain registration data aligns well with the business claims, supporting legitimacy. Overall, the site is professional and trustworthy but could improve in privacy compliance and security transparency. Strategically, the company should prioritize implementing cookie consent and privacy enhancements, publish clear security policies, and adopt security headers to strengthen its security posture and regulatory compliance. These improvements will enhance customer trust and reduce risk exposure.

47
85
60
20
15
58
2
carstorageluxurycartransportclassiccartransportationcarshippingvehicleremovals+2 more
WordPressPHPjQueryGoogle Analytics+6

Partner Domains:

abels.co.uk
partner
blueskycreativeuk.com
partner
2026-07-10T07:16:19.909Z
walsingham.com favicon

Walsingham Support

walsingham.com

57
Non-profitUnited KingdommediumMEDIUM

Walsingham Support is a well-established UK-based charity providing personalized support services for individuals with learning disabilities, autism, brain injuries, and complex needs. With over 40 years of experience, the organization offers bespoke support solutions ranging from a few hours weekly to full 24/7 care. The website reflects a professional and consistent brand image, targeting individuals and families seeking specialized disability support. The charity emphasizes its commitment to quality of life and happiness for its clients. Technically, the website employs a modern technology stack including jQuery, Google Tag Manager, and a proprietary CMS (Grandad Digital). It is mobile-optimized, accessible, and includes cookie consent mechanisms aligned with GDPR requirements. Analytics tools such as Google Analytics and Hotjar are used with user consent. However, some security best practices such as explicit security headers and published security policies are missing. From a security perspective, the site uses HTTPS and manages cookie consent effectively, but lacks visible security policies and incident response contacts. The WHOIS data is unavailable, which raises concerns about domain registration legitimacy and consistency with the claimed 40-year history. No critical vulnerabilities or unsafe content were detected. Overall, the website is professional and trustworthy in content and design but would benefit from improved transparency in domain registration and enhanced security documentation to strengthen trust and compliance.

70
75
100
37
15
83
2
charitydisabilitysupportnon-profitlearningdisabilitiesautism+3 more
jQueryjQuery UIGoogle Tag ManagerGoogle Analytics+2
2026-07-10T07:13:33.156Z
onegas.com favicon

ONE Gas

onegas.com

67
EnergyUnited StateslargeMEDIUM

ONE Gas is a large, publicly traded natural gas distribution company serving over 2.3 million customers across Kansas, Oklahoma, and Texas. It operates through three main divisions: Kansas Gas Service, Oklahoma Natural Gas, and Texas Gas Service. The company is headquartered in Tulsa, Oklahoma, and holds a strong market position as the largest natural gas distributor in Kansas and Oklahoma and the third largest in Texas. The website provides comprehensive investor relations, corporate governance, and customer service information, reflecting a mature and professional business presence. Technically, the website is built on ASP.NET WebForms with modern JavaScript libraries and integrates Google Analytics and OneTrust for privacy compliance. The site is mobile optimized, accessible, and uses HTTPS with a Content Security Policy, indicating a solid digital infrastructure. However, some security headers could be enhanced for improved protection. From a security perspective, the site demonstrates good practices including HTTPS enforcement and cookie consent mechanisms. No critical vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data is a concern but likely due to privacy protection or technical reasons, not necessarily indicating malicious intent. Overall, the security posture is strong but could benefit from publishing incident response and vulnerability disclosure policies. The overall risk assessment is moderate to low, with the main recommendation being to improve transparency around domain registration and enhance security headers. The website is trustworthy, professionally maintained, and compliant with privacy regulations, making it a reliable source for customers and investors alike.

70
75
52
100
65
88
2
energynaturalgasinvestorscorporateutility+3 more
ASP.NET WebFormsjQuerySlick CarouselGoogle Analytics+2

Partner Domains:

kansasgasservice.com
subsidiary
oklahomanaturalgas.com
subsidiary

+2 more partners

2026-07-10T07:13:11.844Z
naiop.org favicon

Commercial Real Estate Development Association

naiop.org

62
Real EstateUnited StateslargeMEDIUM

The Commercial Real Estate Development Association (CREDA) is a leading professional organization dedicated to advancing commercial real estate development across North America. The association provides a comprehensive suite of services including industry education, advocacy on legislative priorities, research publications, and networking opportunities through events and chapters. CREDA targets commercial real estate professionals such as developers, owners, investors, and industry stakeholders, positioning itself as a key resource and thought leader in the sector. Technically, the CREDA website is built on the EPiServer CMS platform and leverages modern web technologies including jQuery, Google Analytics, Microsoft Application Insights, and various UI libraries for a responsive and user-friendly experience. The site demonstrates good mobile optimization and SEO practices, although some accessibility features could be enhanced. Performance is moderate with room for optimization. From a security perspective, the website enforces HTTPS and employs CAPTCHA on forms to mitigate abuse. However, no explicit security headers were detected in the provided data, and there is no visible incident response or vulnerability disclosure information. Privacy compliance is well addressed with a comprehensive privacy policy, cookie consent mechanisms, and GDPR considerations. The WHOIS data is unavailable or privacy-protected, which is common for organizations of this nature. Overall, CREDA presents a professional, trustworthy, and content-rich online presence with a solid technical foundation. Strategic improvements in security headers, incident response transparency, and accessibility would further strengthen its security posture and user trust.

27
100
78
75
30
17
85
commercialrealestatedevelopmentassociationeducationadvocacy+2 more
EPiServer CMSjQueryGoogle AnalyticsMicrosoft Application Insights+4
2026-07-10T07:12:39.921Z
shelbyenergy.com favicon

Shelby Energy Cooperative

shelbyenergy.com

66
EnergyUnited StatesmediumMEDIUM

Shelby Energy Cooperative is a regional electric utility cooperative serving Shelbyville, Kentucky, and surrounding areas. The organization focuses on providing safe, reliable, and cost-effective energy solutions to its members, including residential and business customers. Key services include energy provision, account management via SmartHub, energy audits, renewable energy programs, and electric vehicle resources. The cooperative positions itself as a trusted community energy provider with a strong local presence and customer service focus. Technically, the website is built on the Drupal CMS platform, utilizing modern web technologies such as FontAwesome, Google Tag Manager, and GTranslate for multilingual support. The site demonstrates good mobile optimization, accessibility features, and SEO practices, although performance is moderate. The infrastructure appears stable and professionally maintained. From a security perspective, the website enforces HTTPS and avoids exposing sensitive data. However, it lacks several security headers and does not provide explicit security policies or incident response information. Privacy compliance is basic, with a privacy policy present but no cookie consent mechanism detected. The absence of WHOIS data reduces domain trustworthiness, though the website content and external partnerships suggest legitimacy. Overall, Shelby Energy Cooperative's digital presence is professional and functional, supporting its business objectives effectively. Strategic improvements in security headers, privacy compliance, and domain registration transparency would enhance trust and security posture.

80
62
100
70
85
53
2
energycooperativeutilityrenewableenergyelectricvehicles+1 more
Drupal CMSFontAwesomeGoogle Tag ManagerGoogle Analytics+3

Partner Domains:

shelbyenergy.smarthub.coop
partner
coopwebbuilder3.com
partner
2026-07-10T07:12:34.641Z
dol.gov favicon

U.S. Department of Labor

dol.gov

67
GovernmentUnited StatesenterpriseMEDIUM

The U.S. Department of Labor (DOL) is a federal government agency dedicated to promoting the welfare of job seekers, wage earners, and retirees in the United States. The website serves as a comprehensive portal for labor laws, workplace safety, unemployment insurance, apprenticeship programs, and disaster recovery assistance. It targets American workers, employers, and government entities, providing authoritative resources and regulatory information. The DOL maintains a strong market position as a key government institution with enterprise-level scale and reach. Technically, the website is built on Drupal 10 CMS, leveraging modern web technologies including Google Analytics, Google Tag Manager, and various accessibility and performance tools. The site demonstrates good mobile optimization, accessibility, and SEO practices, with asynchronous loading of analytics scripts to enhance performance. The design is professional, consistent, and user-friendly, reflecting the agency's authoritative brand. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and a public vulnerability disclosure policy. Privacy compliance is strong with a comprehensive privacy policy and GDPR considerations, though a cookie consent mechanism is not evident. The WHOIS data is privacy protected or unavailable, typical for .gov domains, but the domain legitimacy is high given the official .gov TLD and consistent branding. Overall, the DOL website is a secure, credible, and well-maintained government resource. Strategic recommendations include enhancing security headers, publishing vulnerability disclosure information, implementing cookie consent, and providing incident response contacts to further strengthen trust and compliance.

85
80
100
67
30
58
25
governmentlaboremploymentworkplacesafetyunemployment+2 more
Drupal 10Google AnalyticsGoogle Tag ManagerFontAwesome+3
2026-07-10T07:12:23.950Z
silvershieldwindscreens.co.uk favicon

Silver Shield Windscreens

silvershieldwindscreens.co.uk

50
TransportationUnited KingdomsmallMEDIUM

Silver Shield Windscreens is a UK-based company specializing in automotive glass repair and replacement services, including windscreen repairs, replacements, fleet services, specialist glazing, and ADAS recalibration. The company targets fleet owners, business owners, and private vehicle owners across England and Wales, emphasizing quality service at competitive prices with trained technicians and insurance claim support. The website presents a professional image with clear contact details and service descriptions. Technically, the website employs legacy technologies such as jQuery 1.8.3 and Modernizr 2.6.2, alongside Google Analytics and Tag Manager for tracking. The site is mobile-optimized with a cookie consent mechanism, but lacks visible modern security headers and uses an outdated JavaScript library, which may pose security risks. Performance is moderate, and SEO practices are adequately implemented. From a security perspective, the site uses HTTPS (assumed from external scripts loaded via HTTPS), but no explicit security headers were detected in the provided data. The cookie consent banner and privacy policies indicate GDPR compliance efforts, though no incident response or vulnerability disclosure information is present. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy, though the website content is consistent with a legitimate business. Overall, the website is functional and professional but would benefit from technical and security improvements, including updating libraries, implementing security headers, and clarifying domain registration status to enhance trust and compliance.

47
60
85
20
15
95
2
windscreenrepairwindscreenreplacementfleetservicesadasrecalibrationspecialistglazing+3 more
jQuery 1.8.3Google AnalyticsGoogle Tag ManagerModernizr 2.6.2+1
2026-07-10T07:09:34.977Z
directvehicleglass.co.uk favicon

Direct Vehicle Glass

directvehicleglass.co.uk

46
TransportationUnited KingdommediumHIGH

Direct Vehicle Glass is a well-established UK-based company specializing in mobile windscreen repair and replacement services, primarily serving Liverpool, Warrington, Manchester, and the wider North West region. The company positions itself as a leading independent automotive glazing provider with a focus on quality and responsiveness. Their key services include private and commercial vehicle glass repair, fleet cover, and advanced driver assistance system (ADAS) calibration. The website reflects a medium-sized business with a professional online presence and multiple insurance partnerships that enhance trustworthiness. Technically, the website is built on WordPress and utilizes modern web technologies such as jQuery, Slick Carousel, and Google Analytics for tracking. The site is mobile-optimized with good SEO practices implemented via Yoast SEO. Performance is moderate, and accessibility is basic but functional. The site uses HTTPS with an excellent SSL configuration, though it lacks some security headers that could improve its security posture. From a security perspective, the site demonstrates good baseline practices such as HTTPS and no visible sensitive data exposure. However, it lacks published security policies, incident response information, and a cookie consent mechanism, which are important for GDPR compliance and user trust. No vulnerabilities or suspicious content were detected. The domain registration data aligns well with the business claims, indicating legitimacy and a strong trust foundation. Overall, the website is professional, credible, and secure enough for its business purpose but would benefit from enhanced privacy compliance and security transparency to improve user trust and regulatory adherence.

70
65
20
47
53
17
15
windscreenrepairvehicleglassmobileserviceadascalibrationfleetcover+4 more
jQuerySlick CarouselGoogle AnalyticsYoast SEO
2026-07-10T07:07:53.481Z