Skip to main content

Other security reports

Browse 27,894 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157364
Websites
130
Industries
113
Countries
52
Avg Score
Page 30 of 558|Showing 1451-1500 of 27894
K

Kingston Cleaning Services

kingstoncleaningservices.co.uk

51
OtherUnited KingdommediumMEDIUM

Kingston Cleaning Services (KCS) is a UK-based commercial and industrial cleaning company specializing in a wide range of interior and exterior cleaning services across Yorkshire and the UK. The company serves diverse sectors including commercial, industrial, and domestic clients, offering services such as building fabric cleaning, window cleaning, pressure washing, and high-level cleaning. KCS emphasizes health and safety, with trained teams and strong site compliance, positioning itself as a reliable and reputable cleaning partner with over 70 years of combined experience in the industry. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics integrated. The site is mobile-optimized with good navigation and content structure, though some security headers could be improved. The website uses HTTPS and reCAPTCHA for form security, reflecting a moderate to good security posture. Security-wise, the site demonstrates good practices including HTTPS enforcement and no visible vulnerabilities or exposed sensitive data. However, it lacks explicit incident response contacts and a vulnerability disclosure policy, which are recommended for enhanced security maturity. Privacy and cookie policies are present and appear GDPR compliant, supporting privacy compliance. Overall, the website is professional, trustworthy, and well-maintained, though the WHOIS data is unavailable due to domain registration lookup issues. This does not detract from the legitimacy of the business, but it is recommended to verify domain registration details through alternative means. Strategic improvements in security headers and incident response transparency would further strengthen the security posture.

40
70
60
57
17
15
68
cleaningcommercialcleaningindustrialcleaningwindowcleaningpressurewashing+3 more
WordPressYoast SEOGoogle Tag ManagerGoogle Analytics+2
2026-07-03T07:09:43.497Z
susmangodfrey.com favicon

Susman Godfrey L.L.P.

susmangodfrey.com

74
OtherUnited StateslargeMEDIUM

Susman Godfrey L.L.P. is a premier litigation law firm specializing in complex and high-stakes legal cases. The firm is highly ranked nationally, holding the Vault #1 litigation boutique position in the US for over a decade. Their services focus on trial law, class actions, privacy litigation, business disputes, arbitration, and pro bono work, targeting corporations, plaintiffs, and defendants involved in litigation. The website reflects a mature and professional legal services business with a strong market presence. Technically, the website is built on WordPress with modern technologies such as jQuery, Algolia Search for enhanced search functionality, and Google Analytics for visitor insights. The site is well optimized for SEO, mobile responsive, and fast loading, indicating a high level of digital maturity. Privacy compliance is robust with clear privacy and cookie policies and a consent mechanism. From a security perspective, the site uses HTTPS with a valid SSL certificate and employs cookie consent blocking for analytics scripts. However, no explicit security headers were detected in the HTML source, and no incident response or security policy pages were found. The WHOIS data is unavailable, which slightly reduces transparency but is common for professional firms protecting registrant privacy. Overall, the security posture is good but could be improved with additional headers and published security policies. The overall risk assessment is low, with the main recommendation being to enhance security headers and incident response visibility. The website is trustworthy, professional, and compliant with privacy regulations, making it suitable for its target audience and business model.

100
85
80
54
95
17
80
lawfirmlitigationlegalservicesprivacycookieconsent+3 more
jQueryAlgolia SearchGoogle AnalyticsYoast SEO+2
2026-07-03T07:08:25.028Z
W

Wrigleys Solicitors LLP

wrigleys.co.uk

64
OtherUnited KingdommediumMEDIUM

Wrigleys Solicitors LLP is a well-established specialist law firm operating primarily in the UK with offices in Leeds, Sheffield, and Newcastle. The firm focuses on advising private clients, charities, trustees, and businesses in sectors such as trusts, tax, pensions, property, agriculture, education, and employment law. Their market position is reinforced by multiple industry certifications and recognitions, including Legal 500 and Chambers rankings. The website reflects a professional and comprehensive digital presence with clear navigation and rich content tailored to their target audience. Technically, the website employs modern web technologies including jQuery, Bootstrap, Google Analytics, Google Tag Manager, and Google reCAPTCHA for security on forms. The site is mobile-optimized and demonstrates good SEO practices. While no explicit CMS or hosting provider was identified, the infrastructure appears stable and performant. From a security perspective, the site uses HTTPS with a strong SSL configuration and implements cookie consent and CAPTCHA mechanisms to protect user data and prevent abuse. However, security headers are not explicitly detected and no public security or incident response policies are found, indicating room for improvement in transparency and defense-in-depth. Overall, the website is trustworthy and professional with no signs of malicious activity or content safety concerns. The lack of WHOIS data due to domain query failure limits full domain legitimacy verification, but the business credentials and content strongly support authenticity. Strategic recommendations include enhancing security headers, publishing incident response information, and continuous monitoring of third-party scripts.

57
85
70
100
30
68
17
lawlegalsolicitorstrustspensions+4 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle reCAPTCHA+5
2026-07-03T07:06:52.756Z
allenmellon.com favicon

Allen & Mellon

allenmellon.com

55
OtherUnited KingdomsmallMEDIUM

Allen & Mellon is a small ecological consultancy firm specializing in environmental and ecological services across the UK and Ireland. With over three decades of experience, they provide a comprehensive range of services including field surveys, impact assessments, management plans, biodiversity audits, training, and advice. Their client base includes government agencies, conservation organizations, and private sector entities, positioning them as a trusted provider in their niche market. The website is professionally designed on the Squarespace platform, offering clear navigation and relevant content tailored to their target audience. Technically, the website leverages Squarespace's hosting and content management capabilities, incorporating Typekit fonts and standard web technologies such as JavaScript and CSS. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and SEO optimization. Security-wise, the site enforces HTTPS but lacks additional security headers and policies, which could enhance its security posture. No forms or analytics scripts were detected, indicating minimal data collection and tracking. The WHOIS data for the domain is missing or unavailable, which raises some concerns about domain registration legitimacy. However, the active and professional website presence suggests a legitimate business. The absence of privacy, cookie, and terms of service policies indicates potential compliance gaps, especially regarding GDPR. Overall, the site presents a trustworthy and professional image but would benefit from enhanced security and compliance measures.

54
75
55
100
17
35
35
ecologyconsultancyenvironmentukireland+1 more
SquarespaceTypekit FontsJavaScriptCSS
2026-07-03T07:06:24.731Z
kdmevents.co.uk favicon

KDM Events Ltd

kdmevents.co.uk

59
OtherUnited KingdommediumMEDIUM

KDM Events Ltd is a UK-based corporate events management company specializing in team building, conferences, and corporate event services. The company positions itself as an award-winning provider delivering services across the UK, targeting corporate clients seeking professional event planning and management. Their key offerings include team building activities, conference management, audio visual services, content and design, audience engagement, and awards ceremonies. The website reflects a medium-sized business with a professional and consistent brand presence. Technically, the website is built on WordPress and leverages a modern technology stack including jQuery, Google Analytics, Google Tag Manager, Google reCAPTCHA, New Relic monitoring, and CookieYes for consent management. The site is mobile optimized and demonstrates good SEO practices with structured data and meta tags. Performance is moderate with room for improvement in accessibility. From a security perspective, the site enforces HTTPS, uses reCAPTCHA to mitigate spam, and implements cookie consent mechanisms. However, it lacks visible security headers and does not publish a privacy policy or terms of service within the analyzed content. The WHOIS data is unavailable or invalid, raising concerns about domain registration legitimacy, although the website content itself appears professional and trustworthy. Overall, the website presents a solid business and technical foundation but should address privacy policy publication, improve security headers, and clarify domain registration details to enhance trust and compliance.

37
100
70
60
20
17
95
corporateeventsteambuildingconferencemanagementukbusinesseventplanning
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+9
2026-07-02T07:21:22.771Z
vesselgallery.com favicon

Vessel Gallery

vesselgallery.com

58
OtherUnited KingdomsmallMEDIUM

Vessel Gallery is a London-based contemporary art gallery specializing in high-end art glass, ceramics, sculpture, and decorative lighting. The gallery positions itself as a UK leader in museum-quality contemporary art glass and serves collectors, interior designers, and art enthusiasts. Their business model revolves around exhibitions, sales, and commissions, supported by a professional online presence and active social media engagement. The website is powered by the MasterArt platform, indicating a specialized infrastructure for art galleries. Technically, the website employs modern web technologies including jQuery, Bootstrap 4.3.1, and Slick Carousel for UI components, alongside Google Analytics and Mailchimp for marketing and analytics. The site is mobile-optimized with good SEO practices and a cookie consent mechanism, reflecting a moderate to good digital maturity level. However, some security headers and explicit security policies are not evident, suggesting room for improvement in security hardening. From a security perspective, the site uses HTTPS and has implemented cookie consent, but lacks visible security headers and incident response information. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data for the domain is a concern and reduces trustworthiness, although the website content and business information appear legitimate and professional. Overall, the website scores well in content quality and privacy compliance but could improve in security posture and domain registration transparency. Strategic recommendations include enhancing security headers, verifying domain registration details, and adding incident response contacts to strengthen trust and compliance.

70
57
100
75
2
68
15
artglasscontemporaryartgallerysculptureceramics+4 more
jQueryBootstrap 4.3.1Slick CarouselGoogle Analytics+1
2026-07-02T07:20:42.683Z
nortonpeskett.co.uk favicon

Norton Peskett Solicitors

nortonpeskett.co.uk

48
OtherUnited KingdommediumHIGH

Norton Peskett Solicitors is a well-established law firm based in East Anglia, UK, with a history dating back to the 1830s. The firm offers a comprehensive range of legal services to both individuals and businesses, including criminal defence, family law, employment law, residential and commercial property, injury claims, mediation, and wills and probate. With multiple branch offices and over 120 experienced employees, Norton Peskett holds a strong regional market position supported by numerous accreditations and client testimonials. The website reflects a professional and trustworthy business with clear contact information and a user-friendly design. Technically, the website is built on WordPress 7.0 with modern SEO and analytics tools such as Yoast SEO, Google Analytics, Google Tag Manager, and Hotjar. It employs HTTPS with good SSL configuration and uses Google reCAPTCHA to secure forms. Cookie consent mechanisms and a privacy policy indicate GDPR compliance. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contact is published. From a security perspective, the site demonstrates good practices including HTTPS enforcement, anti-phishing warnings, and form protection. The absence of WHOIS data is unusual but likely due to querying the subdomain 'www' rather than the root domain. Despite this, the business legitimacy is supported by consistent branding, accreditations, and detailed contact information. Overall, the site scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility. Recommendations include implementing comprehensive security headers, publishing a security policy and incident response contacts, and adding a security.txt file to facilitate vulnerability disclosures. These steps would enhance the security posture and trustworthiness further.

65
20
60
47
53
15
17
lawfirmsolicitorslegalserviceseastangliafamilylaw+5 more
WordPress 7.0Yoast SEO pluginGoogle AnalyticsGoogle Tag Manager+3

Partner Domains:

www.eastmediation.co.uk
partner
unity.online
partner
2026-07-02T07:19:51.531Z
kingstonrecruitment.co.uk favicon

Kingston Recruitment Ltd

kingstonrecruitment.co.uk

46
OtherUnited KingdomsmallHIGH

Kingston Recruitment Ltd is a well-established recruitment agency based in Hull, East Yorkshire, specializing in office and commercial recruitment services including temporary, contract, and permanent placements. Founded in 1985, the company serves both candidates and clients with a strong regional presence and a reputation for quality service. The website reflects a professional business model focused on staffing solutions for a variety of sectors. Technically, the website employs a modern frontend stack including Bootstrap, jQuery, Owl Carousel, and integrates live chat via Tawk.to and analytics through Google Analytics and Tag Manager. The site is mobile optimized and provides a good user experience with clear navigation and relevant content. Security posture is moderate; HTTPS is implied but no security headers were detected in the provided data, and no explicit security or incident response policies are published. Privacy compliance is basic with a privacy policy present but lacking cookie consent mechanisms. WHOIS data could not be retrieved due to domain naming issues, which raises concerns about domain registration consistency but does not directly impact the legitimacy of the business as presented on the site. Overall, the website is professional and trustworthy but would benefit from enhanced security and privacy practices.

70
65
20
57
15
17
53
recruitmentjobsemploymenthulleastyorkshire+3 more
jQueryBootstrapOwl CarouselPrettyPhoto+2
2026-07-02T07:18:08.585Z