Skip to main content

Media security reports

Browse 14,097 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157364
Websites
130
Industries
113
Countries
52
Avg Score
Page 3 of 282|Showing 101-150 of 14097

对话地球

chinadialogue.net

64
MediaN/asmallMEDIUM

Dialogue Earth is an independent non-profit organization focused on delivering compelling environmental journalism and fostering informed global conversations about climate and environmental issues. The website positions itself as a trusted source for global climate and environment news, targeting a general audience interested in sustainability and environmental topics. The business model is centered on non-profit journalism with a focus on quality content and global outreach. Technically, the website is built on WordPress CMS, leveraging modern plugins such as Yoast SEO Premium for search optimization and GrassBlade LMS for learning management features. The site uses Cloudflare DNS and includes media player and carousel libraries to enhance user experience. Security posture is solid with HTTPS enabled, domain locking, and no critical vulnerabilities detected, though DNSSEC is not enabled and no explicit security or incident response policies are published. Privacy compliance is strong with GDPR-compliant privacy and cookie policies and active consent mechanisms. Overall, the site demonstrates a good balance of content quality, technical implementation, security, and privacy compliance, making it a credible and trustworthy platform for environmental news.

42
80
70
100
95
15
25
environmentclimatejournalismnon-profitnews+1 more
WordPressYoast SEO PremiumjQueryGrassBlade LMS plugin+3

Partner Domains:

chinadialogue.net
partner
2026-07-09T07:17:34.423Z
I

Institute for Social and Cultural Communications, Inc.

zmag.org

65
MediaN/asmallMEDIUM

ZNetwork is an established independent left-leaning media outlet providing news, analysis, commentary, and educational content since 1977. The organization operates a multilingual WordPress-based website featuring articles, videos, podcasts, and digital books aimed at a general audience interested in social and political issues. The business model relies on donations and community support, positioning itself as a niche media provider with a consistent brand and professional content quality. Technically, the website leverages a modern WordPress CMS with popular plugins such as Elementor for page building, GiveWP for donations, and CleanTalk for anti-spam protection. Hosting and DNS services are provided by reputable providers including NameCheap and Cloudflare, with HTTPS enabled ensuring secure communications. The site demonstrates good mobile optimization and SEO practices but lacks some advanced security headers and DNSSEC. From a security perspective, the site maintains a good baseline with HTTPS and anti-spam measures but lacks published security policies, incident response contacts, and vulnerability disclosure mechanisms. Privacy compliance is weak due to the absence of privacy and cookie policies and consent mechanisms, which could expose the organization to regulatory risks. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website is trustworthy and professionally maintained but would benefit from enhanced privacy compliance and security transparency to improve user trust and regulatory adherence.

27
75
85
100
65
73
17
independentmedianewsanalysisleftpoliticseducation+3 more
WordPressPHPjQueryElementor+5
2026-07-08T07:26:12.044Z
inkdistribution.co.uk favicon

Ink Distribution Ltd

inkdistribution.co.uk

51
MediaUnited KingdomsmallMEDIUM

INK Distribution Ltd operates as a specialized magazine distributor in the United Kingdom, focusing on ethical, spiritual, and niche magazine titles. The company serves retailers and publishers by supplying a broad catalog of magazines and sourcing requested titles not currently in their inventory. The website presents a professional and consistent brand image with clear navigation and relevant content tailored to its target audience of retailers, publishers, and magazine readers. Technically, the site is built on WordPress using the Genesis Framework and employs jQuery and Google Fonts, indicating a moderately modern infrastructure. Performance and mobile optimization are basic but functional. From a security perspective, the website benefits from HTTPS encryption but lacks important security headers and privacy compliance mechanisms such as privacy and cookie policies. No contact information for security incidents or data protection officers is provided, which limits transparency and compliance with GDPR best practices. The WHOIS data for the domain is unavailable due to domain naming rule violations, raising concerns about domain registration legitimacy, although the website content itself appears legitimate and professional. Overall, the site is accessible and functional with good content quality and business credibility but requires improvements in privacy compliance, security headers, and domain registration transparency to enhance trustworthiness and regulatory adherence. Strategic recommendations include implementing comprehensive privacy and cookie policies, adding security headers, improving mobile and accessibility features, and clarifying domain registration details.

57
45
70
100
15
35
17
magazinedistributionethicalconsumerspiritualmagazineswordpressgenesisframework
jQueryWordPressGenesis FrameworkGoogle Fonts
2026-07-07T07:16:22.122Z
tbaplc.co.uk favicon

TBA GROUP

tbaplc.co.uk

58
MediaUnited KingdommediumMEDIUM

TBA Group is a professional agency specializing in creating impactful events and cultural movements across sports, brands, and entertainment sectors. The company operates globally with offices in London, Birmingham, Sydney, and Los Angeles, serving rights holders and brands with culture-first campaigns and communications. Their business model focuses on event activation, brand partnerships, and entertainment collaborations, positioning them as a bold and global player in the media industry. Technically, the website is built on WordPress using Elementor and Smart Slider 3, indicating a modern CMS with good mobile optimization and moderate performance. The site uses HTTPS and includes marketing tracking scripts from Lead Forensics and Demandbase, but lacks some security headers and cookie consent mechanisms. From a security perspective, the site has a good SSL configuration but misses several security best practices such as security headers and published incident response policies. The absence of WHOIS data raises concerns about domain registration legitimacy, although the professional website and consistent branding mitigate some risk. Overall, the website is professional and trustworthy but would benefit from enhanced security practices and clearer compliance mechanisms. Further verification of domain registration is recommended to ensure legitimacy.

75
100
70
47
65
17
15
agencyeventssportsbrandsentertainment+2 more
WordPressElementorSmart Slider 3jQuery

Partner Domains:

velocityexperience.com
partner
www.top-b.com
partner

+1 more partners

2026-07-07T07:14:01.681Z
sohoeditors.com favicon

Soho Editors

sohoeditors.com

55
MediaUnited KingdommediumMEDIUM

Soho Editors is a well-established UK-based freelance talent agency and training provider specializing in post-production recruitment and education. Founded in 1997, the company offers a comprehensive range of services including freelance and permanent recruitment, bespoke and online training courses, and project support for media professionals. Their market position is strong within the UK media sector, supported by a professional website with clear navigation and rich content tailored to post-production professionals and companies seeking creative talent. Technically, the website employs a modern tech stack including Bootstrap, jQuery, Google Analytics, Tag Manager, and various marketing and tracking tools. The site is mobile-optimized with good SEO practices and moderate performance. Hosting and domain registration are consistent with the business profile, though DNSSEC is not enabled. Security measures include HTTPS enforcement and Google reCAPTCHA on forms, but there is room for improvement in security headers and explicit security policies. The security posture is solid but could be enhanced by enabling DNSSEC and adding security headers such as CSP and HSTS. Privacy compliance is strong with clear privacy and cookie policies, GDPR consent mechanisms, and multiple contact points. No critical vulnerabilities or suspicious content were detected. Overall, the website presents a professional and trustworthy digital presence with extensive marketing and analytics integration. Strategically, Soho Editors should focus on improving DNS security, publishing a formal security policy, and enhancing HTTP security headers to further strengthen their security posture and trustworthiness.

70
67
40
75
80
2
20
post-productiontalentagencytrainingfreelancerecruitment+2 more
BootstrapjQueryGoogle AnalyticsGoogle Tag Manager+9
2026-07-07T07:07:38.914Z
C

CMP Entertainment

cmpentertainment.com

57
MediaUnited StatesmediumMEDIUM

CMP Entertainment is a boutique live music entertainment company specializing in promoting and producing concerts and tours across the UK, Ireland, Europe, and North America. The company has a strong market presence with millions of tickets sold and over 500 shows annually, working with a diverse range of artists including tribute bands and established acts. Their business model focuses on live event promotion and tour production, targeting music fans and event promoters. The website reflects a professional brand image with consistent design and clear navigation, supporting their market position as an established boutique promoter. Technically, the website is built on the Squarespace platform, leveraging modern web technologies such as Typekit fonts and the Plyr video player. The site demonstrates good mobile optimization and moderate performance, with basic SEO and accessibility features. Hosting and infrastructure are managed by Squarespace, providing reliable uptime and HTTPS security. From a security perspective, the site enforces HTTPS and has HSTS enabled, indicating a good baseline security posture. However, it lacks several recommended security headers and does not provide privacy or cookie policies, which are important for compliance and user trust. The absence of WHOIS registration data raises concerns about domain legitimacy and transparency. No direct contact emails or phone numbers are provided, limiting immediate communication channels. Overall, CMP Entertainment's website is functional and professional but would benefit from enhanced privacy compliance, improved security headers, and clearer domain registration transparency to strengthen trust and regulatory adherence.

100
70
60
54
17
35
50
livemusicconcertpromotionentertainmenttributebandstourproduction+1 more
SquarespaceTypekit fontsPlyr video player
2026-07-07T07:02:23.864Z
roundhouse.org.uk favicon

Roundhouse

roundhouse.org.uk

71
MediaUnited KingdommediumMEDIUM

Roundhouse is a well-established and iconic music and arts venue located in Camden, United Kingdom, with a history dating back to the 1960s. The organization focuses on providing a creative space that empowers communities through music, arts, and cultural events. Their market position is strong within the cultural and entertainment sector, targeting a broad audience interested in arts and live performances. The website reflects a professional and consistent brand image, supported by active social media channels and comprehensive privacy and cookie policies, indicating a mature digital presence. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and integrates various third-party services including Google Tag Manager, Cookiebot for consent management, and Freshbots for chatbot functionality. The site demonstrates good mobile optimization, accessibility, and SEO practices, although some security headers could be improved. Performance is moderate, with a well-structured technical stack that supports the business model effectively. From a security perspective, the site enforces HTTPS and employs cookie consent mechanisms that comply with GDPR. No critical vulnerabilities or exposed sensitive data were detected. However, the WHOIS data for the domain is unavailable due to a domain naming rules violation error from Nominet UK, which is unusual but does not appear to impact the legitimacy of the website itself. The absence of explicit contact emails or phone numbers on the homepage suggests contact information may be located deeper within the site. Overall, the website presents a low risk with a solid security posture and good privacy compliance. Strategic recommendations include enhancing security headers, auditing third-party scripts regularly, and improving transparency around contact and incident response information to further strengthen trust and compliance.

74
100
70
85
70
88
2
artsmusicvenuecultureevents+3 more
WordPress 6.6.2Yoast SEO pluginjQuery 3.7.1Google Tag Manager+4

Partner Domains:

booking.roundhouse.org.uk
service
action.roundhouse.org.uk
service
2026-07-06T07:26:34.484Z
sensible-music.co.uk favicon

Sensible Music Limited

sensible-music.co.uk

54
MediaUnited KingdomsmallMEDIUM

Sensible Music Limited is a well-established recording studio business based in London, UK, with over 35 years of experience in the music industry. The company offers a range of services including recording studio rentals, mixing and mastering, voiceovers, photography, and rehearsal space hire. The website reflects a professional and reputable market position, supported by mentions of high-profile clients and industry memberships such as the Music Producers Guild. The target audience primarily includes musicians, producers, and music industry professionals seeking high-quality recording and production services. Technically, the website is built on WordPress with modern frameworks like Bootstrap and uses popular libraries such as Glide.js and FontAwesome. It integrates marketing and analytics tools including Google Analytics and Mailchimp. The site demonstrates good mobile optimization, SEO practices, and a moderate performance profile. Hosting is likely provided by Easyspace Ltd, consistent with the domain registrar information. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks visible security headers and formal security or incident response policies. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is weak due to the absence of privacy and cookie policies or consent mechanisms. Contact information is clearly presented, enhancing business credibility. Overall, Sensible Music presents a trustworthy and professional online presence with strong business credibility and technical implementation. To improve, the company should implement comprehensive privacy and cookie policies, add security headers, and publish security and incident response information to enhance compliance and security posture.

100
37
60
85
17
15
35
musicrecordingstudiomixingmasteringrehearsals+5 more
WordPress 6.9.4Bootstrap 5Glide.jsFontAwesome 6.7.2+2
2026-07-06T07:19:45.745Z
themadisonsquaregardencompany.com favicon

Madison Square Garden Entertainment Corp.

themadisonsquaregardencompany.com

56
MediaN/aenterpriseMEDIUM

Madison Square Garden Entertainment Corp. (MSGE) operates as a leading global live entertainment company managing iconic venues such as Madison Square Garden Arena, Radio City Music Hall, and others. The company focuses on delivering live events and managing entertainment brands, positioning itself as a world leader in the live entertainment industry. The website reflects a mature digital presence with comprehensive branding, clear navigation, and detailed corporate information. Technically, the site is built on WordPress with modern SEO and analytics tools integrated, including Google Tag Manager and OneTrust for cookie consent, indicating a good level of digital maturity. Security posture is solid with HTTPS enforced and cookie consent implemented; however, explicit security policies and incident response contacts are not publicly available, which could be improved. The absence of WHOIS registration data for the domain is a notable concern, potentially indicating privacy protection or registration issues, which slightly reduces trustworthiness. Overall, the site is professional, well-maintained, and compliant with privacy regulations, serving a general audience interested in live entertainment and corporate information.

32
40
75
100
100
2
15
liveentertainmentcorporatemediavenuemanagementprivacy+3 more
WordPressYoast SEO pluginjQueryGoogle Tag Manager+2

Partner Domains:

msg.com
partner
rockettes.com
partner

+1 more partners

2026-07-05T07:10:40.535Z
A

Axiom Media Ltd

axiommedia.co

64
MediaUnited KingdomsmallMEDIUM

Axiom Media Ltd is a UK-based independent sales house specializing in TV and digital advertising sales on domestic, European, and global levels. The company targets broadcast TV channel owners and digital content platforms seeking to maximize commercial revenue through bespoke sales strategies. With a senior team of former broadcasting executives, Axiom Media positions itself as a trusted partner offering expert services tailored to the life stage of client businesses. The company also operates a subsidiary, Axiom Americas, to serve US broadcast clients, indicating international expansion and market disruption ambitions. Technically, the website is built on WordPress using the Twenty Seventeen theme, enhanced with Yoast SEO and Jetpack plugins. The site demonstrates moderate performance, good mobile optimization, and basic accessibility features. SEO is well implemented with structured data and Open Graph metadata. The site uses HTTPS with excellent SSL configuration, but lacks explicit security headers and formal privacy or cookie policies, which are compliance gaps. From a security perspective, the site shows good practices such as HTTPS enforcement and no visible vulnerabilities or exposed sensitive data. However, the absence of security headers and incident response information suggests room for improvement in security posture. Privacy compliance is weak due to missing policies and consent mechanisms. Overall, the site is professional and trustworthy but would benefit from enhanced compliance and security transparency. The overall risk assessment is moderate with no critical vulnerabilities detected. Strategic recommendations include implementing privacy and cookie policies, adding security headers, and establishing incident response and vulnerability disclosure processes to strengthen trust and compliance.

100
85
100
49
17
30
50
mediaadvertisingtvdigitalsales+2 more
WordPressYoast SEO pluginJetpack pluginjQuery+1

Partner Domains:

axiommediaco.wordpress.com
partner
2026-07-05T07:09:00.171Z
G

Green Row

greenrow.co.uk

53
MediaUnited KingdomsmallMEDIUM

Green Row is a UK-based PR and social media agency specializing in lifestyle, food and drink, and health and wellness sectors. Established in 2005, the agency offers tailored communications campaigns and media relations services, positioning itself as a tenacious and hands-on partner for businesses seeking to enhance their reputation. The website reflects a professional and consistent brand image with clear service offerings and client testimonials, targeting businesses in need of expert PR support. Technically, the website is built on WordPress using modern plugins such as Yoast SEO and MonsterInsights for analytics. The site is mobile-optimized and performs moderately well, though accessibility features are basic. The hosting and domain registration are consistent with the business profile, with a long-standing domain age matching the company's founding year. From a security perspective, the site enforces HTTPS and includes basic best practices such as Google Analytics opt-out functionality. However, it lacks security headers and explicit security or incident response policies. Privacy compliance is weak, with no visible privacy or cookie policies, which is a notable gap given the use of tracking technologies. Overall, the website is trustworthy and professional but would benefit from enhanced privacy compliance and security hardening to improve user trust and regulatory adherence.

70
55
39
100
30
35
17
pragencypublicrelationssocialmediacommunicationsmediarelations+3 more
WordPressYoast SEO pluginGoogle Analytics (MonsterInsights)Jetpack+2
2026-07-04T07:24:26.676Z
agencyspace.co.uk favicon

Agencyspace

agencyspace.co.uk

43
MediaUnited KingdomsmallHIGH

Agencyspace is a well-established independent global creative company specializing in advertising, content creation, and experiential marketing. The company positions itself as a forward-thinking agency that helps brands go beyond conventional marketing approaches to become distinctive and memorable. The website reflects a professional and consistent brand image with clear messaging targeted at ambitious brands seeking innovative marketing solutions. The company operates primarily in the media sector and is based in the United Kingdom, with a domain age indicating a mature business presence since 2003. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and integrates Google Analytics and Tag Manager for tracking. The site demonstrates good mobile optimization, SEO practices, and moderate performance. However, some accessibility features could be improved. Security-wise, the site uses HTTPS and avoids exposing sensitive data, but lacks visible security headers and explicit security policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. Overall, the security posture is adequate but could be enhanced by implementing security headers, cookie consent, and incident response information. The business credibility is high due to clear contact information, professional design, and consistent branding. There are no indications of malicious or adult content, making the site safe for general audiences. The domain registration data supports the legitimacy of the business with consistent and transparent WHOIS information. Strategic recommendations include improving privacy compliance with cookie consent, adding security headers, publishing security and incident response policies, and maintaining regular updates to WordPress and plugins to mitigate vulnerabilities.

70
47
75
-
15
2
53
creativeagencyadvertisingbrandingmediamarketing+1 more
WordPress 7.0Yoast SEO pluginjQueryGoogle Analytics+4
2026-07-04T07:17:49.347Z
fifthframe.co.uk favicon

Fifth Frame Ltd

fifthframe.co.uk

52
MediaUnited KingdomsmallMEDIUM

Fifth Frame Ltd is a London-based video production company specializing in creating dynamic and engaging video content for businesses and elite sports organizations. Their services include promotional films, event video production, content marketing, charity films, business communications, motion graphics, sports production, and big screen content. The company targets professional clients seeking high-quality video storytelling to enhance brand presence and audience engagement. The website reflects a professional and consistent brand image with strong trust indicators such as client logos and testimonials. Technically, the website is built on the Webflow platform, utilizing modern web technologies including Google Fonts, jQuery, and PJAX for seamless page transitions. The site is hosted on Webflow's CDN, ensuring moderate performance and good mobile optimization. SEO and accessibility are adequately addressed, though accessibility features could be improved. No major technical issues or broken elements were detected. From a security perspective, the site uses HTTPS and does not expose sensitive data. However, it lacks important security headers and a cookie consent mechanism, which are recommended for enhanced security and privacy compliance. The WHOIS lookup for the domain 'www.fifthframe.co.uk' failed due to the domain being invalid under Nominet UK rules, indicating the queried domain is a subdomain or misconfigured. This discrepancy lowers domain trustworthiness but does not negate the legitimacy of the business, which likely operates under a valid domain. Overall, the website is professional, content-rich, and trustworthy with minor areas for security and privacy improvements. The domain WHOIS issue should be clarified by verifying the correct registered domain to improve trust and legitimacy perception.

40
54
100
60
2
53
30
videoproductionmediacontentmarketingbusinesscommunicationssportsproduction+3 more
WebflowGoogle FontsjQueryPJAX
2026-07-03T07:00:53.953Z
redearthstudio.com favicon

Red Earth Studio Ltd.

redearthstudio.com

55
MediaUnited KingdomsmallMEDIUM

Red Earth Studio Ltd. is a London-based award-winning film and video production company specializing in branded content and documentaries since 2003. The company targets brands and businesses seeking impactful storytelling through film. Their market position is established and reputable within the media production sector, offering full-service production capabilities. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress 6.9.4 with a modern tech stack including jQuery, Google Analytics, and Mailchimp integrations. The site is mobile-optimized and performs moderately well, though accessibility features are basic. SEO is enhanced by Yoast SEO plugin usage. However, no hosting provider or CDN details were identified. Security posture is adequate with HTTPS enabled and no visible sensitive data exposure. However, the absence of security headers and privacy/cookie policies indicates room for improvement in compliance and security best practices. The WHOIS data is missing, which raises concerns about domain registration transparency, although the website content and business information appear legitimate. Overall, the website is professional and trustworthy but would benefit from enhanced privacy compliance, security headers, and WHOIS transparency to improve trust and security posture.

25
35
2
70
52
85
100
filmvideoproductionmedialondonbrandedcontent+1 more
WordPress 6.9.4jQuery 3.7.1Google AnalyticsYoast SEO plugin+5
2026-07-02T07:25:41.652Z
T

The Marsh Agency

marsh-agency.co.uk

47
MediaUnited KingdomsmallHIGH

The Marsh Agency is a UK-based literary agency established in 1997, offering international representation services to writers, literary agents, and publishing companies. The website reflects a professional and consistent brand presence targeting literary professionals and publishing industry stakeholders. The business model centers on representation and rights management, positioning the agency as an established player in the media sector with a small company size. Technically, the website is built on WordPress with Bootstrap and jQuery frameworks, hosted by Zen Internet Limited. It employs Google Analytics and Tag Manager for user tracking and marketing insights. The site is moderately performant with good mobile optimization and basic accessibility features. SEO practices appear adequate with proper meta tags and structured navigation. From a security perspective, the site uses HTTPS with good SSL configuration but lacks explicit security headers such as CSP or HSTS. Forms include basic anti-spam measures but no visible cookie consent or privacy compliance mechanisms beyond a privacy policy page. No incident response or security policy information is published, indicating room for improvement in security transparency and GDPR compliance. Overall, the website is trustworthy and professionally maintained, with a solid business credibility score. However, enhancements in privacy compliance, security headers, and incident response disclosures would strengthen the security posture and regulatory adherence.

70
20
80
57
53
15
2
literaryagencypublishingwritersrepresentationinternationalrepresentationmedia
jQueryBootstrapGoogle AnalyticsGoogle Tag Manager+2
2026-07-02T07:21:38.943Z
V

Visual Narrative Ltd

visualnarrative.tv

57
MediaUnited KingdomsmallMEDIUM

Visual Narrative Ltd is a small, award-winning creative video production company operating primarily in Belfast and Dublin, serving Northern Ireland, Ireland, and the UK. The company offers a broad range of video production services including TV commercials, brand films, social media videos, animation, and corporate videos. With over 20 years of experience, Visual Narrative positions itself as a premium provider with a strong regional presence and a portfolio that includes broadcast TV and industry awards. The website reflects a professional and consistent brand image with clear contact information and social media integration. Technically, the website is built using Framer, incorporating modern web fonts and scripts such as Google Analytics, Crazy Egg, and Mailchimp for analytics and marketing. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and SEO. Security posture is adequate with HTTPS enabled, but lacks important security headers and explicit privacy and cookie policies, which are critical for GDPR compliance and user trust. From a security perspective, no immediate vulnerabilities or suspicious elements were detected. However, the absence of WHOIS data limits transparency about domain ownership and age, which slightly impacts trustworthiness. The site does not employ a WAF or present any blocking challenges, allowing full content accessibility. Overall, the site is safe, professional, and business-focused with no adult or questionable content. Strategically, Visual Narrative should enhance its privacy and cookie compliance, implement security headers, and publish clear policies to strengthen user trust and regulatory adherence. Adding a security.txt file and improving incident response visibility would further bolster security maturity.

65
100
70
49
40
17
35
videoproductioncorporatevideoanimationtvcommercialsbrandfilms+6 more
Google AnalyticsCrazy EggMailchimpFramer
2026-07-02T07:05:27.159Z
Y

Youth Media (UK) Ltd

youthmedia.co.uk

56
MediaUnited KingdomsmallMEDIUM

Youth Media (UK) Ltd operates as a specialized digital marketing agency focused on student marketing and advertising across UK university campuses. Their services include targeted email campaigns, poster advertising, bookmarks, and mouse mats placed strategically in university libraries and learning centers. The company positions itself as an experienced media owner with over 15 years in the sector, leveraging academic endorsement and exclusive access to student audiences. The website content is professional and consistent with their business focus, targeting university students as their primary audience. Technically, the website employs a standard technology stack including jQuery, Bootstrap 3, Google Analytics, and Hotjar for analytics and user behavior tracking. The site is mobile responsive with good navigation and SEO optimization, though accessibility features are basic. Performance is moderate, and no CMS or hosting provider details are evident. Privacy and cookie policies are present but lack explicit consent mechanisms, and no contact emails or phone numbers are provided on the homepage, limiting direct communication channels. From a security perspective, the site uses HTTPS and includes tracking scripts but lacks visible security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were detected, but the absence of security best practices such as CSP or HSTS headers is noted. The WHOIS lookup failed due to domain registration issues, with no registrar or registrant data available, which raises concerns about domain legitimacy despite the professional website content. Overall, the website presents a moderate risk profile with good business credibility but gaps in security posture and privacy compliance. Strategic recommendations include improving security headers, adding explicit consent mechanisms, providing clear contact information, and verifying domain registration details to enhance trust and com…

42
75
70
100
15
68
2
studentmarketingdigitalmarketinguniversityadvertisingemailmarketingcampusadvertising
jQueryBootstrap 3Google AnalyticsHotjar
2026-07-01T07:20:57.267Z
T

Trickbox TV

trickboxtv.com

63
MediaUnited KingdomsmallMEDIUM

Trickbox TV is a UK-based broadcast services company specializing in multi-camera outside broadcast facilities, equipment hire, virtual events, live streaming, and studio design and system integration. The company targets broadcast professionals, corporate event organizers, and media production companies, positioning itself as a trusted provider with notable clients such as Pfizer, Shell, and Red Bull. The website is professionally designed, content-rich, and optimized for SEO and mobile devices, reflecting a mature digital presence. Technically, the website runs on WordPress with WooCommerce and uses modern JavaScript libraries and Google Tag Manager for analytics and marketing. Performance is moderate with good mobile optimization and basic accessibility features. Security posture is good with HTTPS enforced and cookie consent implemented, though some security headers are missing and no explicit security policy or incident response information is published. The WHOIS data is unavailable, indicating possible domain registration issues or privacy protection, which slightly reduces trustworthiness. However, the professional website, clear contact information, and privacy compliance mitigate concerns. No WAF or blocking mechanisms were detected, and the site content is safe for general audiences. Overall, Trickbox TV demonstrates a solid business and technical foundation with room for improvement in security transparency and WHOIS data clarity. Strategic recommendations include enhancing security headers, publishing security policies, and monitoring domain registration status to strengthen trust and compliance.

62
75
100
70
45
17
58
broadcastoutsidebroadcastequipmenthirevirtualeventsstudiodesign+4 more
WordPress 7.0WooCommerce 9.8.5jQuery 3.7.1Google Tag Manager+4
2026-07-01T07:18:17.938Z
caa.com favicon

Creative Artists Agency

caa.com

72
MediaUnited StatesenterpriseMEDIUM

Creative Artists Agency (CAA) is a leading global talent and sports agency founded in 1975, specializing in entertainment, sports, and brand representation. The company offers a broad range of services including talent management, brand consulting, live event booking, and investment banking. Their website reflects a mature enterprise with a professional design, clear navigation, and comprehensive business information targeting entertainment and sports professionals as well as brands. The presence of multiple global office locations and contact details underscores their extensive market reach. Technically, the website is built on Drupal CMS and leverages modern JavaScript libraries such as jQuery and Lodash, alongside Google Tag Manager for analytics and OneTrust for cookie consent management. The site is mobile-optimized and accessible, with good SEO practices evident. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contacts are published, which could be improved. Security posture is moderate with HTTPS implied and cookie consent mechanisms in place, but the absence of explicit security headers and vulnerability disclosure reduces the security maturity score. The WHOIS data is unavailable or protected, which slightly impacts trustworthiness, though the website content and business information strongly support legitimacy. Overall, CAA's website demonstrates a high level of professionalism and compliance with privacy regulations, making it a trustworthy platform for its audience. Strategic improvements in security transparency and WHOIS data availability would further enhance trust and security posture.

80
85
100
82
2
88
55
talentagencyentertainmentsportsbrandmanagementprivacy+2 more
jQueryLodashGoogle Tag ManagerOneTrust Cookie Consent
2026-07-01T07:17:14.880Z
C

CB Global Holdings Ltd

creativebrief.com

64
MediaN/amediumMEDIUM

Creativebrief operates as a next-generation agency search consultancy and intelligence hub, targeting progressive brands and agencies seeking to enhance their marketing impact. The company offers a range of services including pitch consultancy, marketing capability development, and industry thought leadership content. Positioned as a modern and strategic partner, Creativebrief leverages technology and expert advice to connect brands with agencies effectively. The website reflects a professional and consistent brand image with good content quality and user experience. Technically, the website is built on Concrete5 CMS and utilizes modern web technologies such as jQuery, Bootstrap, HubSpot forms, and Osano for consent management. The site is mobile-optimized, accessible, and integrates analytics and marketing tools like Google Tag Manager and HubSpot. Performance is moderate, with good SEO and accessibility features. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms, but lacks visible security headers and explicit security policies. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS registration data is a notable concern, potentially impacting domain legitimacy trust. Overall, the site maintains a good security posture but could improve transparency and security best practices. The overall risk assessment is moderate with recommendations to enhance security headers, publish incident response and vulnerability disclosure policies, and verify domain registration details to strengthen trust and compliance.

75
100
65
42
17
68
65
agencysearchmarketingconsultancyintelligencehubcreativeagencies+2 more
jQueryBootstrapGoogle Tag ManagerHubSpot Forms+3
2026-06-29T07:19:22.915Z