Skip to main content

Manufacturing security reports

Browse 6,821 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157364
Websites
130
Industries
113
Countries
52
Avg Score
Page 7 of 137|Showing 301-350 of 6821
inspectionsystemservices.co.uk favicon

Inspection System Services

inspectionsystemservices.co.uk

46
ManufacturingUnited KingdomsmallHIGH

Inspection System Services (ISS) is a UK-based specialist company providing metal detection and check weighing inspection services primarily to the food production industry. Established in 1996, ISS offers a range of services including maintenance contracts, consultancy, training, equipment sales, and technical support. The company positions itself as a trusted partner to major UK food producers and retailers, emphasizing safety and compliance. The website reflects a professional business presence with clear service offerings and client logos, targeting UK food manufacturers and retailers. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and uses Google Analytics and Google Tag Manager for tracking. The site is mobile-optimized and has good SEO practices but lacks some advanced accessibility features. Hosting is provided by 123-Reg Limited, consistent with the UK location. Performance is moderate with standard modern web technologies. From a security perspective, the site uses HTTPS and does not expose sensitive data in the HTML. However, it lacks important security headers like Content-Security-Policy and HSTS, and no privacy or cookie policies are published, which is a compliance risk under GDPR. No incident response or vulnerability disclosure information is available. The site uses tracking technologies but does not provide explicit user consent mechanisms. Overall, the website is professional and trustworthy but requires improvements in privacy compliance and security hardening to reduce risk and enhance user trust. Adding privacy and cookie policies, security headers, and incident response information would strengthen the security posture and regulatory compliance.

70
57
60
40
53
15
2
inspectionmetaldetectioncheckweighingfoodproductionconsultancy+3 more
WordPress 7.0.1Yoast SEO pluginjQuery 2.2.0Google Tag Manager+5
2026-07-13T07:27:00.216Z
servosteel.com favicon

Steelstrip Services Ltd t/a Servosteel

servosteel.com

58
ManufacturingUnited KingdommediumMEDIUM

Servosteel is a UK-based steel service centre specializing in toll processing, coil pickling, slitting, decoiling, laser services, and steel sales. Positioned as the UK's leading independent steel processor, the company offers a comprehensive suite of steel processing and sales services supported by an online marketplace and customer portal. The website reflects a professional business with ISO 9001 and ISO 14001 certifications, indicating a commitment to quality and environmental standards. Technically, the site is built on ASP.NET Web Forms with legacy jQuery and includes interactive features such as sliders and cookie consent mechanisms. While the site is accessible and well-structured, some technical aspects like outdated libraries and missing security headers suggest room for improvement. The security posture is moderate, with no critical vulnerabilities detected but lacking advanced security headers and incident response information. The absence of WHOIS data for the domain raises concerns about domain transparency, although the website content and certifications support business legitimacy. Overall, the site scores well in content quality and business credibility but should address technical and security enhancements to improve trust and compliance.

65
100
80
57
15
73
2
steelprocessingcoilpicklingslittingdecoiling+5 more
ASP.NET Web FormsjQuery 1.7.1Nivo SliderThickbox+1
2026-07-13T07:25:19.901Z
moyola.com favicon

Moyola Precision Engineering

moyola.com

52
ManufacturingUnited KingdommediumMEDIUM

Moyola Precision Engineering is an established UK-based company founded in 1976, specializing in integrated machining and assembly solutions primarily for the Civil Aerospace, Defence, Space, and Industrial sectors. The company holds a prestigious ADS SC21 Gold award, highlighting its operational excellence and innovation. Their business model focuses on B2B manufacturing services, offering a range of expertise including CADCAM, quality inspection, milling, and titanium machining. The website reflects a professional and consistent brand image targeting industrial clients globally. Technically, the website is built on WordPress using popular plugins such as Yoast SEO, WPBakery Page Builder, and Slider Revolution. It employs Google Analytics and a cookie consent mechanism compliant with GDPR, indicating a mature digital infrastructure. The site is mobile-optimized with good SEO practices, though accessibility features are basic. Performance is moderate, with room for optimization. From a security perspective, the site uses HTTPS with no visible exposed sensitive data or vulnerable libraries. However, it lacks explicit security headers and dedicated security or incident response pages. The cookie consent implementation is robust, but there is no security.txt or vulnerability disclosure policy. The WHOIS data is missing, which raises concerns about domain registration transparency, though the website content and contact details suggest legitimacy. Overall, Moyola Precision Engineering presents a credible and professional online presence with solid privacy compliance. The main risk lies in the lack of WHOIS transparency and some missing security best practices. Strategic improvements in security headers, incident response visibility, and domain registration clarity are recommended to enhance trust and security posture.

70
20
85
47
80
17
20
manufacturingprecisionengineeringaerospacedefenseindustrial+3 more
WordPressYoast SEOWPBakery Page BuilderSlider Revolution+3
2026-07-13T07:20:25.163Z
kestevencomponents.co.uk favicon

Kesteven Components Ltd

kestevencomponents.co.uk

63
ManufacturingUnited KingdomsmallMEDIUM

Kesteven Components Ltd is a small UK-based manufacturing business specializing in supplying hardwood and softwood edge-laminated panels and timber products primarily to the furniture trade. Established in 1996 and located in Sleaford, Lincolnshire, the company offers a range of products including worktops, tabletops, kitchen doors, and CNC/laser engraving services. Their market position is that of a trusted regional supplier with a focus on B2B relationships within the UK Midlands furniture manufacturing community. The website reflects a professional and consistent brand presence with good content quality and clear navigation tailored to their target audience of furniture manufacturers and related businesses. Technically, the website is built on a proprietary Website Editor platform hosted likely by 1&1 IONOS with modern JavaScript libraries such as jQuery and skrollr for animations. The site uses HTTPS with good SSL configuration and content delivery via Cloudfront CDN, ensuring moderate performance and good mobile optimization. However, accessibility features are basic, and SEO is adequately addressed through meta tags and structured content. From a security perspective, the site enforces HTTPS and includes a cookie consent banner, but lacks important security headers and explicit privacy or terms of service pages. No WHOIS data is available due to domain naming errors, which raises concerns about domain registration legitimacy despite the professional website content. No forms or email contacts are present on the homepage, limiting direct data collection points. Analytics are implemented via Snowplow, indicating moderate user tracking. Overall, the website presents a trustworthy and professional front for a small manufacturing supplier but would benefit from improved transparency in privacy and security policies, domain registration clarity, and enhanced security headers to strengthen its security posture and compliance. The lack of WHOIS data is a notable r…

69
70
85
100
50
53
2
hardwoodsoftwoodpanelsedge-laminatedcnc+5 more
jQuery 2.2.4skrollrCloudfront CDNWebsite Editor platform (1AND1_EU_PROD)+3
2026-07-13T07:15:41.166Z
acmeseals.com favicon

Acme Seals Group

acmeseals.com

48
ManufacturingMalaysiamediumHIGH

Acme Seals Group is a well-established manufacturer and supplier of tamper-evident security seals with a history dating back to 1884. The company operates globally with a significant presence in Malaysia and the UK, offering a wide range of customizable security seals including plastic, metal, barrier, meter, and padlock seals. Their market position is strong, supported by ISO-9001:2015 certification and a reputation for quality and reliability across multiple industries such as maritime, aviation, cargo, and retail. Technically, the website is built on WordPress using modern technologies like jQuery, Bootstrap, and Google Analytics for tracking. The site is mobile-optimized and provides a good user experience with clear navigation and professional design. However, there is room for improvement in accessibility and performance optimization. From a security perspective, the site uses HTTPS and implements basic anti-spam measures in forms but lacks advanced security headers and explicit security policies. There is no visible incident response or vulnerability disclosure information, which could be enhanced to improve trust and compliance. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. Overall, the website and business demonstrate a solid and trustworthy presence with moderate technical and security maturity. Strategic improvements in security headers, privacy compliance, and incident response transparency would further strengthen their posture and customer confidence.

47
70
80
20
15
17
53
securitysealsmanufacturingtamper-evidentmalaysiaiso-9001+1 more
jQueryGoogle AnalyticsGoogle Tag ManagerGravity Forms+1
2026-07-13T07:13:50.917Z
granorte.pt favicon

GRANORTE - Revestimentos de Cortiça, Lda.

granorte.pt

39
ManufacturingPortugalmediumHIGH

GRANORTE - Revestimentos de Cortiça, Lda. is a well-established Portuguese family-owned manufacturing company founded in 1972, specializing in cork coatings and flooring products. The company holds a strong market position as one of the leading cork manufacturers, offering a wide range of cork flooring and wall tile products, including custom design solutions and a room floor simulator tool. The website is professionally designed with multilingual support, targeting both B2B and end customers interested in sustainable cork products. Technically, the site uses modern web technologies such as Google Analytics, Facebook Pixel, and Google reCAPTCHA, and is built on the AZCMS by LOBA platform. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. Security posture is solid with HTTPS enforced and bot protection on forms, though there is room for improvement in security headers and explicit incident response policies. Privacy compliance is partially met with a comprehensive privacy policy and terms of service, but lacks a visible cookie consent mechanism. Overall, the website is trustworthy and professional, reflecting the company's credibility and market standing.

62
65
55
-
20
28
2
manufacturingcorkflooringdesignsustainability+2 more
Google AnalyticsFacebook PixelGoogle reCAPTCHAFlickity Carousel+2

Partner Domains:

www.loba.pt
partner
www.trendcollectionbygranorte.com
related

+1 more partners

2026-07-13T07:11:49.905Z
camberleyrubber.com favicon

Camberley Rubber Mouldings Ltd

camberleyrubber.com

45
ManufacturingUnited KingdommediumHIGH

Camberley Rubber Mouldings Ltd is a well-established UK-based specialist manufacturer of bespoke rubber mouldings and custom rubber products, serving industrial, commercial, and military sectors worldwide. Founded in 1969 and part of the Camberley Group PLC, the company offers a comprehensive range of rubber manufacturing services including injection moulding, bonding, compression, and transfer moulding, supported by advanced tooling and product design advice. The website reflects a mature business with a strong market position and a broad customer base. Technically, the website is built on WordPress and leverages modern technologies such as Google Analytics and Snitcher for analytics and tracking. It is hosted on a performant platform (likely Pressidium) with good mobile optimization and SEO practices. The site includes a cookie consent mechanism and privacy policy indicating GDPR compliance, though explicit security headers are not evident. Security posture is solid with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. However, the absence of WHOIS registration data and lack of published security policies or incident response contacts represent areas for improvement. Overall, the site is professional, trustworthy, and well-maintained but would benefit from enhanced transparency in security and domain registration details. Strategically, the company should focus on improving security disclosures and ensuring domain registration transparency to bolster trust and compliance, while continuing to leverage its strong brand and technical capabilities to maintain market leadership.

75
55
20
47
50
15
17
rubbermouldingmanufacturingcustomrubberproductsindustrialtechnicalmanufacturing+1 more
Google AnalyticsSnitcherjQueryWordPress+1

Partner Domains:

www.camberleygroupplc.com
parent
www.camlocksafety.com
partner

+1 more partners

2026-07-12T07:26:15.485Z
precision-refrigeration.co.uk favicon

Precision Refrigeration

precision-refrigeration.co.uk

65
ManufacturingUnited KingdommediumMEDIUM

Precision Refrigeration is a UK-based manufacturer specializing in professional refrigeration equipment for commercial kitchens. Their product range includes cabinets, counters, blast chillers, and specialized refrigeration units, supported by a dedicated spares webshop. The company targets professional kitchens and hospitality sectors, emphasizing robust and reliable products with strong customer service. Technically, the website is built on the Squarespace platform, leveraging modern web technologies and analytics tools such as Google Analytics and Tag Manager. The site is mobile-optimized and presents a professional design with clear navigation. Security-wise, the site enforces HTTPS and uses reCAPTCHA for forms, but lacks explicit privacy policies and security disclosures, which are areas for improvement. The absence of WHOIS data for the domain raises some concerns about domain registration transparency, although the website content and structure suggest a legitimate business. Overall, the site scores well on content quality and technical implementation but should enhance privacy compliance and domain registration transparency to improve trust and security posture.

54
100
80
70
80
17
50
refrigerationprofessionalkitchenmanufacturingcommercialrefrigerationsquarespace
Squarespace CMSGoogle AnalyticsGoogle Tag ManagerreCAPTCHA

Partner Domains:

precision-spares.com
partner
precision-refrigeration.com.cn
related

+2 more partners

2026-07-12T07:22:41.346Z
tubeandsteel.com favicon

Tube and Steel Supplies Ltd

tubeandsteel.com

63
ManufacturingUnited KingdommediumMEDIUM

Tube and Steel Supplies Ltd is a medium-sized, privately owned steel stockholder and processor based in Newport, South Wales, established in 1999. The company specializes in supplying quality steel tubes, fittings, flanges, and related products, servicing both UK and international markets. Their key services include cutting, galvanising, threading, welding, fabrication, shot blasting, coating, and international export, positioning them as a leading distributor in their sector. The website reflects a professional business presence with clear contact information and service descriptions. Technically, the website is built on the MultiScreenSite CMS platform, utilizing modern web technologies such as jQuery, Slick Slider, Google Tag Manager, and Snowplow Analytics. It supports progressive web app features via service workers and is hosted on a reliable CDN infrastructure. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. From a security perspective, the site enforces HTTPS and uses secure forms with opt-in consent. However, explicit security headers are not detected, and there is no visible incident response or vulnerability disclosure information. The absence of WHOIS data for the domain raises concerns about domain registration legitimacy, although the website content and business information appear trustworthy and professional. Overall, the site presents a solid business and technical foundation but would benefit from enhanced security practices and clearer domain registration transparency to improve trust and compliance.

59
55
100
75
53
17
70
steelstockholderprocessorpipefittings+7 more
jQuery 3.7.0Slick SliderGoogle Tag ManagerSnowplow Analytics+4
2026-07-12T07:22:03.793Z
2

2D Engineering Ltd

2d-engineering.com

52
ManufacturingUnited KingdomsmallMEDIUM

2D Engineering Ltd is a small, independent UK-based manufacturing company specializing in precision CNC machining services including turning, grinding, and milling. Founded in 1992 and located near Ashford, Kent, the company serves a diverse range of engineering sectors such as aerospace, defense, scientific, electronics, automotive, petrochemical, and industrial tooling. Their business model focuses on medium to low volume manufacturing with a strong emphasis on customer collaboration and problem-solving. The website reflects a professional and consistent brand image with clear contact information and trust indicators such as UKAS certification and company registration details. Technically, the website employs a legacy jQuery version alongside modern tools like Google Analytics and CookieConsent for GDPR compliance. The site is mobile optimized with good SEO practices and a moderate performance profile. However, the absence of security headers and use of outdated libraries present moderate technical risks. The site uses HTTPS, ensuring secure communications. From a security perspective, the website demonstrates basic best practices including cookie consent and encrypted connections but lacks advanced security headers and incident response disclosures. The missing WHOIS registration data is a significant concern, potentially indicating domain registration issues that could affect trustworthiness. No forms or social media links are present, limiting attack surface but also reducing engagement channels. Overall, the website is professional and trustworthy from a business perspective but requires improvements in security posture and domain registration transparency. Strategic recommendations include implementing security headers, updating JavaScript libraries, publishing security policies, and verifying domain registration status to enhance credibility and compliance.

-
70
70
52
35
17
95
engineeringcncmanufacturingprecisionmachiningkent+3 more
jQuery 2.2.4ModernizrFontAwesomeGoogle Analytics+2
2026-07-12T07:21:10.022Z
V

Venturi Jet Pumps Ltd

venturipumps.com

50
ManufacturingUnited KingdomsmallMEDIUM

Venturi Jet Pumps Ltd is a specialized manufacturer of venturi process equipment with over 20 years of experience serving diverse industrial sectors including food, wastewater treatment, power, chemical, petrochemical, and aerospace. Their product portfolio includes eductors, syphons, heaters, exhausters, compressors, thermocompressors, desuperheaters, vacuum ejectors, and gas scrubbers, catering to global industrial clients. The company emphasizes custom design solutions to optimize operational efficiency. Technically, the website employs legacy technologies such as jQuery 1.8.3 and common UI libraries like Owl Carousel and Lightcase. The site is moderately optimized for performance and mobile responsiveness but lacks modern security headers and updated libraries. No CMS or hosting provider details are evident. SEO and accessibility are basic but adequate for the business domain. From a security perspective, the site uses HTTPS as implied by canonical links but lacks explicit security headers and privacy policies. The outdated jQuery version presents a potential vulnerability. No forms collect sensitive data, reducing immediate risk exposure. WHOIS data is missing or inaccessible, which raises concerns about domain registration legitimacy despite professional website content and clear contact information. Overall, the website presents a professional industrial business front with good content quality and business credibility but requires improvements in privacy compliance, security best practices, and domain registration transparency to enhance trust and reduce risk.

55
60
62
100
15
35
2
industrialmanufacturingventuripumpsprocessequipmentengineering
jQuery 1.8.3jQuery UIOwl CarouselLightcase+2
2026-07-12T07:20:16.175Z
vola.com favicon

VOLA

vola.com

61
ManufacturingDenmarkmediumMEDIUM

VOLA is a Danish manufacturing company specializing in taps and accessories characterized by timeless Scandinavian design and exceptional craftsmanship since 1968. The company positions itself as a premium brand with a strong heritage, targeting architects, designers, and discerning consumers worldwide. Their business model emphasizes made-to-order production, customization, and a modular product system, supported by a global dealer and specialist network. Technically, the website employs modern web technologies including AngularJS, Google Tag Manager, and Cookiebot for consent management, hosted likely behind Cloudflare, ensuring good performance and mobile optimization. Security posture is strong with HTTPS enforcement, CSRF protection, and cookie consent mechanisms, though explicit security policies and incident response contacts are not publicly available. Privacy compliance is well addressed with a comprehensive GDPR-aligned privacy policy and cookie consent banner. The absence of WHOIS data for the domain limits full trust verification, but the website's professional presentation and external social media presence support legitimacy. Overall, the site demonstrates a mature digital presence with room for improvement in transparency of security and contact information.

65
27
100
70
95
17
35
scandinaviandesigntapsaccessoriesdanishcraftsmanshipprivacypolicy+4 more
AngularJS (ng-app, ng-scope)Google Tag ManagerCookiebot for consent managementSwiper.js for sliders+3
2026-07-12T07:18:54.947Z
A

A Wardle & Co (Casters) Ltd.

awardle.co.uk

57
ManufacturingUnited KingdomsmallMEDIUM

A Wardle & Co (Casters) Ltd. is an independent manufacturer specializing in lost wax casting, located in the Birmingham Jewellery Quarter, UK. The company targets jewellery manufacturers and designers, offering specialized manufacturing services. The website reflects a professional and consistent brand image with clear contact information and a user-friendly interface. However, the WHOIS data for the queried domain www.awardle.co.uk is unavailable due to domain naming rules violations, indicating the actual domain in use is likely awardle.co.uk, which aligns with the company's email and contact details. Technically, the website employs modern JavaScript libraries such as Barba.js and AOS for smooth page transitions and animations, with a responsive design optimized for mobile devices. The site lacks visible security headers and privacy policies, which are critical for compliance and security posture. The contact form collects personal data with a GDPR opt-in checkbox but does not link to a privacy or cookie policy, representing a compliance gap. From a security perspective, the site uses HTTPS (assumed from the URL), but no explicit security headers were detected in the HTML content. There are no signs of WAF or blocking mechanisms, and no analytics or tracking scripts were found, indicating minimal user tracking. The absence of privacy and cookie policies and security headers lowers the overall security and privacy compliance scores. Overall, the website is functional, professional, and relevant to its manufacturing niche but requires improvements in security headers, privacy compliance, and WHOIS domain consistency to enhance trust and reduce risk.

69
70
100
70
30
2
50
manufacturinglostwaxcastingjewellerybirminghamindependentmanufacturer
HTML5CSS3JavaScript
2026-07-12T07:18:38.327Z
sait-abrasives.co.uk favicon

SAIT Abrasives (UK) Ltd

sait-abrasives.co.uk

47
ManufacturingUnited KingdommediumHIGH

SAIT Abrasives (UK) Ltd is a well-established industrial manufacturer specializing in coated and bonded abrasives, serving the UK and European markets. Founded in 1953 as part of the larger SAIT Abrasivi S.p.A., the company offers a comprehensive product catalog and technical support services, positioning itself as a leader in the abrasives industry. The website reflects a professional B2B business model targeting industrial customers across multiple sectors including metal, wood, building materials, and automotive. Technically, the website is built on the PrestaShop CMS platform, utilizing modern JavaScript libraries and tracking tools such as Google Analytics and Hotjar. It is mobile-optimized and provides a good user experience with clear navigation and relevant content. Security-wise, the site enforces HTTPS and uses secure forms but lacks some recommended security headers and incident response disclosures. Privacy and cookie policies are present with consent mechanisms, indicating basic GDPR compliance. WHOIS data could not be retrieved due to a domain query error, but the website content and contact information strongly suggest legitimacy. Overall, the site demonstrates a solid digital presence with room for security and compliance enhancements.

70
65
52
20
68
2
20
abrasivesmanufacturingindustrialcoatedabrasivesbondedabrasives+2 more
jQueryGoogle AnalyticsGoogle Tag ManagerHotjar+4
2026-07-12T07:18:32.941Z

开云手机官方站登录入口-开云(中国)

mad4digital.com

53
ManufacturingN/amediumMEDIUM

The website represents a Chinese manufacturing company specializing in pumps, valves, and control cabinets, emphasizing quality management under ISO9001 standards. The business targets industrial sectors such as chemical, pharmaceutical, power generation, and metallurgy. The company highlights its technical expertise, product variety, and after-sales service capabilities. However, the website lacks critical business contact information and privacy or security policies, which limits trust and transparency. Technically, the site uses common front-end libraries like jQuery, Bootstrap, Swiper, and WOW.js, but lacks modern SEO and accessibility features. The presence of an embedded iframe from an unrelated external domain raises security concerns. There is no evidence of HTTPS enforcement or security headers, indicating a weak security posture. The WHOIS data is missing or unavailable, which is a significant concern for domain legitimacy and trust. The absence of privacy policies and contact details further reduces compliance with data protection regulations. Overall, the site appears functional but lacks essential security and compliance features, exposing it to potential risks. Strategic recommendations include securing the domain registration, implementing HTTPS with proper security headers, removing or securing external iframe content, adding privacy and cookie policies, and providing clear contact and incident response information to improve trust and compliance.

69
70
60
100
30
50
2
manufacturingindustrialpumpsvalveschineseiso9001
jQueryBootstrapSwiperWOW.js
2026-07-12T07:08:37.710Z
beardengineering.co.uk favicon

The Beard Engineering Company Limited

beardengineering.co.uk

60
ManufacturingUnited KingdomsmallMEDIUM

Beard Engineering is a UK-based family-owned business specializing in high-quality metal machining services including precision planing, plano-milling, and CNC machining. Established since the 1940s, it serves diverse industrial sectors such as railway, mining, nuclear power, renewable energy, shipping, aerospace, and agriculture. The company emphasizes quality workmanship and holds ISO 9001 certification, positioning itself as a trusted provider in the manufacturing sector. The website reflects a professional and consistent brand image with clear service offerings and contact information. Technically, the website is built on the Web Wizard 2 CMS platform and utilizes a range of JavaScript libraries including jQuery and RequireJS. It is mobile-optimized with good accessibility and SEO practices. Google Analytics is implemented for user tracking, complemented by a cookie consent banner ensuring GDPR compliance. However, the site lacks explicit security headers and incident response information, which are areas for improvement. Security posture is moderate with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. The absence of WHOIS data due to domain registration errors raises concerns about domain legitimacy, though the website content and business details appear authentic. Overall, the site is safe, professional, and suitable for its industrial audience but would benefit from enhanced security practices and clearer domain registration transparency. Strategic recommendations include implementing security headers, publishing a vulnerability disclosure policy, improving incident response visibility, and verifying domain registration details to strengthen trust and compliance.

60
57
70
100
30
17
68
engineeringmetalmachiningcncplaningmanufacturing+2 more
jQuery 3.4.0RequireJSGoogle AnalyticsCycle2 jQuery plugin+3
2026-07-11T07:25:52.847Z
nafem.org favicon

NAFEM

nafem.org

62
ManufacturingUnited StatesmediumMEDIUM

NAFEM is a well-established trade association representing over 600 commercial food service equipment and supplies manufacturers with a history spanning more than 70 years. The organization provides key services including advocacy, certification programs such as the Certified Foodservice Professional (CFSP), industry events like The NAFEM Show, and educational resources. Their market position is strong within the manufacturing and non-profit sectors, targeting industry professionals and manufacturers primarily in the United States. Technically, the website is built on a modern WordPress CMS platform, utilizing reputable plugins such as Yoast SEO and Cookiebot for privacy compliance. The site employs Google Tag Manager and analytics tools, ensuring good SEO and performance optimization. Hosting infrastructure leverages Azure DNS, and the site is mobile-optimized with good accessibility features. From a security perspective, the site enforces HTTPS with a solid SSL configuration and employs cookie consent mechanisms aligned with GDPR requirements. However, there is room for improvement by enabling DNSSEC, adding security headers, and publishing explicit security policies and incident response contacts. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website demonstrates a high level of professionalism, trustworthiness, and compliance with privacy regulations. The domain registration is consistent with the organization's history, enhancing legitimacy. Strategic recommendations include enhancing DNS security, publishing security policies, and expanding incident response transparency to further strengthen trust and security posture.

65
98
100
37
2
25
83
tradeassociationfoodserviceequipmentmanufacturingadvocacycertification+2 more
WordPress 7.0.1Yoast SEO pluginGoogle Tag ManagerCookiebot+3

Partner Domains:

thenafemshow.org
partner
cfsp.nafem.org
partner

+1 more partners

2026-07-11T07:24:01.771Z
columbiaforestproducts.com favicon

Columbia Forest Products

columbiaforestproducts.com

74
ManufacturingUnited StateslargeMEDIUM

Columbia Forest Products is a leading North American manufacturer specializing in sustainable hardwood plywood, decorative panels, and veneers for residential and commercial projects. Established in 1957, the company has a strong market position as the largest manufacturer in its sector, serving contractors, architects, designers, and DIY enthusiasts. Their business model focuses on manufacturing and wholesale distribution, supported by a comprehensive North American mill network. The website reflects a professional and well-branded digital presence with multi-language support and extensive product and resource offerings. Technically, the website is built on modern frameworks including Next.js and React, hosted on Vercel, and managed via Agility CMS. It employs advanced analytics and cookie consent tools such as HubSpot and OneTrust, ensuring GDPR compliance and user privacy. The site is optimized for performance, mobile responsiveness, accessibility, and SEO, providing an excellent user experience. From a security perspective, the site enforces HTTPS with strong SSL configurations and includes standard security headers. However, it lacks a publicly available security policy or incident response information, and no vulnerability disclosure mechanism is present. The absence of WHOIS data for the domain is a notable concern, potentially indicating privacy protection or lookup issues, which slightly impacts the domain's trustworthiness. Overall, Columbia Forest Products presents a secure, professional, and trustworthy online presence with minor areas for improvement in transparency around security policies and domain registration details. Strategic recommendations include publishing a security policy, establishing an incident response contact, and adding a vulnerability disclosure page to enhance trust and compliance.

85
100
70
62
17
85
88
manufacturinghardwoodplywoodsustainablewoodproductsdecorativepanelsgreenbuilding+2 more
ReactNext.jsHubSpot AnalyticsVercel Analytics+1
2026-07-11T07:23:45.141Z
mattressmanufacturersderby.com favicon

R & S Furnishings (Nottingham) Limited

mattressmanufacturersderby.com

46
ManufacturingUnited KingdomsmallHIGH

R & S Furnishings (Nottingham) Limited is a small UK-based manufacturer specializing in sofa bed mattresses, serving commercial customers primarily in Derby, Nottingham, Leicester, and the wider East Midlands region. With over 25 years of industry experience, the company offers a range of mattress products including budget, standard, deluxe, and supreme pocket sprung mattresses, along with bespoke manufacturing services. The website reflects a focused business model targeting commercial clients and furniture retailers, emphasizing quality and reliability. Technically, the website employs a custom CMS with common web technologies such as jQuery, Google Analytics, Google reCAPTCHA, and Font Awesome. The site is mobile-optimized with good SEO practices and basic accessibility features. Hosting and DNS are managed through NameSilo and getyouonline.co.uk, respectively. Performance is moderate, and the site includes a cookie consent mechanism and privacy policy, indicating some level of privacy compliance. From a security perspective, the site uses HTTPS and Google reCAPTCHA to protect its contact form, but lacks advanced security headers and DNSSEC is not enabled. No incident response or security policy information is provided, which could be improved. The WHOIS data is consistent with the business claims, showing a mature domain age and no privacy protection, supporting legitimacy. Overall, the website presents a professional and trustworthy business presence with room for improvement in security hardening and compliance transparency. Strategic enhancements in security headers, DNSSEC, and incident response disclosures would strengthen the security posture and trustworthiness of the site.

85
-
47
70
68
20
2
mattresssofabedmanufacturingderbycommercialsupply+1 more
jQueryGoogle AnalyticsGoogle reCAPTCHAFont Awesome
2026-07-11T07:16:40.982Z