Skip to main content

United States security reports

Browse 10,264 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 170 of 206|Showing 8451-8500 of 10264
tpco.com favicon

The Preiss Company

tpco.com

0
Real EstateUnited StateslargeHIGH

The Preiss Company is a well-established leader in the ownership and management of multifamily and student housing communities across the United States. Positioned as one of the top 10 off-campus student housing providers nationally and the largest woman-owned operator in this sector, the company offers a comprehensive portfolio and investment platform focused on delivering superior living experiences. Their website reflects a professional and consistent brand image, targeting students, property investors, and housing clients with clear service offerings and extensive portfolio showcases. Technically, the website employs modern JavaScript libraries, Google Analytics, and Google Tag Manager for tracking, hosted on DigitalOcean infrastructure with a CMS powered by Resite. The site is mobile-optimized with good SEO and accessibility basics, though some improvements are possible. Security posture is moderate; HTTPS is used, but DNSSEC is not enabled and no explicit security headers were detected. Privacy compliance is basic with a cookie consent banner and privacy policy present, but no GDPR-specific indicators or data protection officer information. Overall, the domain registration is consistent and trustworthy, supporting the company's legitimacy. Strategic improvements in security policies and technical hardening would enhance trust and compliance.

15
53
2
55
57
80
40
studenthousingpropertymanagementrealestatemultifamilyhousingoff-campushousing+1 more
jQuery 3.7.0OwlCarousel 2.3.4Google AnalyticsGoogle Tag Manager+4
2025-06-27T12:56:17.667Z
lokalise.co favicon

Lokalise Inc.

lokalise.co

0
TechnologyUnited StatesmediumMEDIUM

Lokalise Inc. operates a SaaS localization and translation management platform designed to integrate seamlessly into software development workflows, enabling faster delivery of localized products. The company is positioned as a user-friendly solution targeting developers, product teams, and localization managers. Founded in 2016 and based in the USA, Lokalise maintains a medium-sized business profile with a consistent brand presence and good content quality on its website. Technically, the website leverages modern JavaScript technologies, including Google Tag Manager, Visual Website Optimizer, and OneTrust for cookie consent management. Hosting is provided via Amazon AWS infrastructure, ensuring reliable performance and scalability. The site demonstrates good mobile optimization and basic accessibility features, with SEO best practices implemented through meta tags and structured data. From a security perspective, the website employs HTTPS and domain transfer protection, but lacks DNSSEC and explicit security headers. No published security policies or incident response contacts were found, indicating room for improvement in transparency and security governance. Privacy compliance is partially addressed through cookie consent mechanisms, but the absence of a visible privacy policy and terms of service reduces compliance confidence. Overall, Lokalise presents a credible and professional online presence with moderate security posture and technical maturity. Strategic enhancements in privacy documentation, security policy publication, and DNS security would strengthen trust and compliance.

65
88
17
85
-
85
100
localizationtranslationsaastechnologysoftware+1 more
JavaScriptGoogle Tag ManagerVisual Website Optimizer (VWO)OneTrust Cookie Consent+1
2025-06-27T12:56:17.254Z
korin.com favicon

Korin, Inc

korin.com

0
RetailUnited StatesmediumHIGH

Korin, Inc is a specialized e-commerce retailer focused on professional quality Japanese chef knives, tableware, kitchenware, and restaurant supplies. Established in 1982, the company serves professional chefs, restaurants, and culinary enthusiasts worldwide, offering a wide range of imported Japanese knives, sharpening stones, kitchen tools, and barware. The website demonstrates a strong market position in the niche culinary supply sector with worldwide shipping and additional services such as knife sharpening and custom engraving. Technically, the website is built on the NetSuite SuiteCommerce platform, utilizing modern JavaScript libraries and frameworks such as RequireJS and jQuery. The site is mobile-optimized with good SEO practices and moderate performance. However, some accessibility features could be improved. The technical infrastructure appears stable and professional, supporting a seamless user experience. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks visible security headers and explicit incident response or vulnerability disclosure information. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. The absence of WHOIS data for the domain raises concerns about domain registration legitimacy, though the website content and business presence appear credible. Overall, Korin.com is a professional and trustworthy e-commerce site with strong business credibility and good technical implementation. Addressing domain registration transparency, enhancing privacy compliance, and improving security headers would further strengthen its security posture and trustworthiness.

-
35
17
70
-
80
100
japanesekniveskitchenwaretablewarerestaurantsuppliese-commerce+1 more
JavaScriptAJAXRequireJSjQuery+2
2025-06-27T12:56:16.985Z
ziegler.com favicon

B.C. Ziegler and Company

ziegler.com

0
FinanceUnited StateslargeMEDIUM

B.C. Ziegler and Company operates as a specialty investment bank focusing on healthcare, senior living, education, and municipal finance sectors. The firm provides capital raising, strategic advisory, sales and trading, and proprietary investments. It holds a strong market position with top rankings in senior living financing and healthcare M&A. The website reflects a mature digital presence with professional design, clear navigation, and comprehensive content tailored to institutional clients and municipal entities. Technically, the website employs modern tracking and analytics tools such as Google Tag Manager and Hotjar, uses lazy loading for images, and is built on a SiteBuilder CMS platform. The site is mobile optimized and accessible, with good SEO practices. However, there is room for improvement in security headers and privacy compliance mechanisms. Security posture is solid with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. The absence of WHOIS data raises some concerns but is mitigated by the presence of regulatory trust signals and professional content. Privacy compliance could be enhanced by implementing cookie consent banners and publishing incident response contacts. Overall, the website and business demonstrate a high level of professionalism and trustworthiness, suitable for their target market. Strategic improvements in privacy and security transparency would further strengthen their risk profile and compliance stance.

55
53
2
65
-
85
100
investmentbankinghealthcarefinanceseniorlivingfinancingcapitalmarketsfhahudmortgagelending+2 more
Google Tag ManagerHotjarSlick CarouselLazyLoad images
2025-06-27T12:56:16.981Z
dorianlpg.com favicon

Dorian LPG Ltd

dorianlpg.com

0
EnergyUnited StatesmediumMEDIUM

Dorian LPG Ltd is a leading liquefied petroleum gas shipping company specializing in the ownership and operation of very large gas carriers (VLGCs). With a global footprint including offices in the United States, Greece, and Denmark, the company plays a critical role in transporting LPG to support the world's energy transition. The website serves primarily as an investor relations portal, providing comprehensive financial reports, ESG disclosures, and corporate governance information. The company is publicly traded on the NYSE under the ticker LPG, reinforcing its market credibility and transparency. Technically, the website is built on a mature ASP.NET WebForms platform integrated with Q4 Inc's investor relations tools, leveraging modern JavaScript libraries such as jQuery, Splide.js, and DataTables for enhanced user experience. The site demonstrates good mobile optimization, accessibility, and SEO practices, with a moderate performance profile. Security measures include HTTPS enforcement, Content Security Policy headers, anti-CSRF tokens, and Google reCAPTCHA integration, reflecting a solid security posture. No critical vulnerabilities or WAF blocks were detected, and the domain registration details align well with the company's public profile, indicating legitimacy and trustworthiness. Privacy and cookie policies are present and comprehensive, with active consent mechanisms, supporting GDPR compliance. However, explicit security policies, incident response contacts, and terms of service pages are absent, representing areas for improvement. Overall, the website is professional, secure, and well-suited for its investor relations purpose, though enhancements in security transparency and contact information could further strengthen trust and compliance.

35
83
17
85
57
85
100
investorrelationsenergytransportationlpgshippingsustainability+2 more
jQuerySplide.jsDataTablesGoogle reCAPTCHA+3
2025-06-27T12:56:16.698Z
M

Marksmen Brand Protection Services

marksmen.com

0
OtherUnited StatesmediumMEDIUM

Marksmen Brand Protection Services is a specialized firm providing intellectual property investigations, acquisitions, and brand protection services globally. The company targets brand owners, legal professionals, marketing agencies, and corporate leadership with a comprehensive suite of services including trademark investigations, on-site investigations, discreet purchases, and market research. The website reflects a mature business with a professional online presence and a broad international client base. Technically, the site is built on WordPress with the Divi theme and integrates multiple marketing and analytics tools such as Google Analytics, HubSpot, and Hotjar, indicating a modern digital infrastructure. Security posture is solid with HTTPS enforced and use of reCAPTCHA on forms, though explicit security headers could be improved. Privacy and cookie policies are present with consent mechanisms, supporting GDPR compliance. However, the absence of WHOIS registration data raises concerns about domain legitimacy, which impacts overall trust. Strategic recommendations include enhancing security headers, publishing a security policy, and verifying domain registration details to improve credibility and trust.

30
68
2
75
62
80
100
intellectualpropertybrandprotectiontrademarkinvestigationsipacquisitionsmarketresearch+1 more
WordPressDivi ThemejQueryGoogle Analytics+5

Partner Domains:

portal.marksmen.com
service
2025-06-27T12:56:16.655Z
remo.com favicon

Remo Inc.

remo.com

0
RetailUnited StateslargeMEDIUM

Remo Inc. is a well-established global leader in the percussion industry, specializing in the innovation, design, production, and distribution of drum heads, drums, and accessories. With over 65 years of history, Remo serves a diverse audience including musicians, educators, and wellness practitioners. The company maintains a strong market position through its commitment to quality and innovation, supported by a comprehensive online presence featuring detailed product information, educational resources, and community engagement. Technically, the website is built on the Webflow platform, leveraging modern JavaScript libraries, analytics tools such as Google Analytics and Facebook Pixel, and cookie consent mechanisms that comply with GDPR. The site demonstrates excellent performance, mobile optimization, and accessibility features, providing a professional and user-friendly experience. From a security perspective, the site uses HTTPS with strong SSL configuration and employs privacy-conscious analytics settings. However, it lacks certain security headers and does not publish a dedicated security policy or vulnerability disclosure, which are areas for improvement. The WHOIS data confirms the domain's legitimacy and long-term registration, reinforcing trustworthiness. Overall, Remo.com presents a secure, compliant, and professionally managed digital presence that aligns well with its business goals and audience needs. Strategic enhancements in security transparency and DNS security could further strengthen its posture.

60
88
2
85
69
75
100
musicpercussiondrumsdrumheadsmusicalinstruments+3 more
Webflow CMSJavaScriptjQuery 3.5.1Google Tag Manager+3
2025-06-27T12:56:16.603Z
maximus.com favicon

Maximus

maximus.com

0
GovernmentUnited StatesenterpriseLOW

Maximus is a well-established enterprise specializing in providing technology and operational support services primarily to government agencies across federal, state, and local levels. Their offerings include customer experience solutions, technology services such as AI and cybersecurity, health services modernization, and program services that help transform policy into outcomes. The company operates globally with regional subsidiaries and maintains a strong market position as a trusted partner to public sector organizations. Technically, the website is built on Adobe Experience Manager, hosted on AWS infrastructure, and integrates modern analytics and consent management tools such as Google Tag Manager, Crazy Egg, and OneTrust. The site is mobile-optimized, accessible, and SEO-friendly, reflecting a mature digital presence. Performance is moderate, with room for optimization. From a security perspective, Maximus employs HTTPS with strong domain registration protections and cookie consent mechanisms, though DNSSEC is not enabled. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of a public security policy or incident response contact is noted. Overall, the website demonstrates high professionalism, strong business credibility, and good privacy compliance. The risk profile is low, with recommendations to enhance DNS security and publish explicit security policies to further strengthen trust and compliance.

55
88
47
75
82
80
100
governmenttechnologyhealthcarepublicservicesconsulting+1 more
Adobe Experience ManagerGoogle Tag ManagerCrazy EggOneTrust Consent Management+1

Partner Domains:

maximuscanada.ca
subsidiary
maximus-india.com
subsidiary

+3 more partners

2025-06-27T12:56:16.506Z
standoutweb.dk favicon

Webnorth

standoutweb.dk

0
TechnologyUnited StatessmallMEDIUM

Webnorth is a specialized digital agency based in Copenhagen with over 14 years of experience in custom WordPress and WooCommerce development. They position themselves as a technical partner for agencies and businesses, offering tailored web solutions, hosting, and service agreements. Their market position is strong within the niche of WordPress development, emphasizing performance, scalability, and security. The website is professionally designed, multilingual (Danish and English), and optimized for SEO and mobile use. Technically, the site leverages WordPress CMS with integrations including Google Analytics, Matomo, Hotjar, Google Tag Manager, and Cloudflare DNS services. The infrastructure supports fast performance and good accessibility. Privacy compliance is robust, featuring a comprehensive cookie consent mechanism aligned with GDPR and Google Consent Mode. Security posture is solid with HTTPS enforced, security headers present, and domain registration consistent with business claims. No critical vulnerabilities or exposed sensitive data were detected. However, DNSSEC is not enabled, and no explicit security or incident response policies are published, which could be improved. Overall, Webnorth presents a trustworthy and professional digital presence with strong technical and privacy compliance foundations. Strategic recommendations include enabling DNSSEC, publishing security policies, and enhancing transparency around incident response and data protection officer contacts.

20
65
17
85
75
80
100
wordpresswoocommercedigitalagencycustomdevelopmenthosting+3 more
WordPressWooCommerceGoogle AnalyticsMatomo Analytics+3
2025-06-27T12:56:16.221Z
lidoadvisors.com favicon

Lido Advisors, LLC

lidoadvisors.com

0
FinanceUnited StateslargeMEDIUM

Lido Advisors, LLC is a well-established private wealth management and advisory firm targeting high net worth individuals, families, charities, and institutions. The company emphasizes a family office style of wealth management, offering services such as financial and estate planning, investment management, tax consulting, and trust services. With over $25 billion in regulatory assets under management and a presence across multiple U.S. offices, Lido positions itself as a sophisticated and trusted advisor in the wealth management sector. The website reflects a professional and polished brand image, with clear messaging and comprehensive service descriptions. Technically, the website is built on Drupal 9 with modern frameworks like Bootstrap 5, and integrates analytics and monitoring tools such as Google Analytics, Google Tag Manager, and New Relic. The site is mobile-optimized, accessible, and performs well, providing a seamless user experience. Security measures include HTTPS enforcement and CAPTCHA on forms, though explicit security headers and policies could be improved. The security posture is solid with no evident vulnerabilities or exposed sensitive data. However, the absence of WHOIS registration data for the domain is a notable anomaly that slightly impacts trustworthiness. The site includes privacy and cookie policies with consent mechanisms, indicating good privacy compliance. Overall, the website and business present a low-risk profile with strong professionalism but would benefit from enhanced transparency in domain registration and security disclosures.

50
68
17
70
95
80
100
privatewealthmanagementwealthadvisoryfinancialplanninginvestmentmanagementtrustservices+1 more
Drupal 9Bootstrap 5Google Tag ManagerGoogle reCAPTCHA+2

Partner Domains:

lido.addepar.com
partner
2025-06-27T12:56:15.192Z
eswagner.com favicon

E.S. Wagner Company

eswagner.com

0
TransportationUnited StateslargeHIGH

E.S. Wagner Company is a large regional construction firm specializing in a broad range of infrastructure projects including highway construction, bridges, rail facilities, airport construction, and energy services. The company operates multiple physical locations across Ohio, South Carolina, and North Carolina, indicating a significant operational footprint. Their website presents a professional image with detailed service offerings and clear contact information, targeting clients in the transportation and energy sectors as well as potential employees. Technically, the website employs a modern but standard technology stack including Bootstrap, jQuery, Font Awesome, and Google Fonts. The site is mobile optimized and provides a good user experience with clear navigation and professional design. However, performance is moderate and accessibility features are basic. The site uses Google Analytics for user tracking but lacks advanced privacy compliance mechanisms such as cookie consent banners or privacy policies. From a security perspective, the site lacks visible security headers and published security policies. The absence of WHOIS registration data is a notable concern, potentially indicating domain registration privacy or data unavailability, which impacts trustworthiness. No critical vulnerabilities or exposed sensitive data were detected in the HTML content. Overall, the security posture is moderate but could be improved with better SSL configuration, security headers, and published policies. The overall risk assessment suggests the company operates a legitimate business with a professional web presence but should address compliance gaps and improve transparency around domain registration and security policies to enhance trust and reduce risk.

15
35
2
70
72
75
-
constructionhighwayinfrastructureequipmentcareers+1 more
jQueryBootstrap 3.3.5Font Awesome 4.4.0Google Fonts (Roboto, Open Sans)+2
2025-06-27T12:56:15.016Z
bayseal.com favicon

Bay Seal Company

bayseal.com

0
ManufacturingUnited StatesmediumHIGH

Bay Seal Company is a well-established manufacturer and distributor of sealing products and gaskets based in Hayward, California, with a history dating back to 1957. The company offers a broad range of sealing solutions including O-rings, Kalrez products, custom molded shapes, and spring energized PTFE seals, serving diverse industrial sectors. Their business model focuses on providing high-quality products combined with engineering support, local inventory, and customer service. The website reflects a medium-sized enterprise with consistent branding and good content quality, targeting industrial customers requiring specialized sealing solutions. Technically, the website is built on WordPress with Bootstrap and jQuery, leveraging Google Tag Manager and Analytics for tracking. The site is mobile-optimized and SEO-friendly, though performance is moderate. Security posture is adequate with HTTPS enabled and secure forms, but lacks advanced security headers and published security policies. Privacy compliance is minimal, with no visible privacy or cookie policies, which is a gap for GDPR and other regulations. The WHOIS data is missing, which raises concerns about domain registration legitimacy despite the active and professional website presence. This inconsistency should be addressed to improve trust. Overall, the site is professional and functional but would benefit from enhanced privacy, security policies, and WHOIS transparency to strengthen its security and compliance posture.

20
35
2
60
72
75
20
manufacturingsealingproductsgasketsindustrialdistribution+1 more
WordPressBootstrap 4jQueryGoogle Tag Manager+3
2025-06-27T12:56:14.622Z
reprisedigital.com favicon

KINESSO

reprisedigital.com

0
TechnologyUnited StateslargeMEDIUM

KINESSO is a technology-driven performance marketing agency founded in 2019 and operating as a part of IPG Mediabrands. The company specializes in integrating media, data, audience insights, analytics, and creative architecture to deliver measurable marketing outcomes for brands. Their service offerings include audience development, digital experience optimization, search marketing, social media, programmatic advertising, commerce strategies, addressable content, curated marketplaces, platform intelligence, and AI-powered solutions. The website reflects a professional and modern digital presence with strong branding and clear messaging targeted at businesses seeking advanced marketing technology solutions. Technically, the website is built on WordPress, leveraging modern technologies such as Google Tag Manager, Vimeo API, and GDPR compliance plugins. It is hosted likely on Microsoft Azure infrastructure, indicated by Azure DNS servers. The site is mobile-optimized, accessible, and SEO-friendly, with good performance metrics. Privacy compliance is well addressed with a comprehensive privacy policy and cookie consent mechanism, including strict necessary cookies and analytics cookies with clear user controls. From a security perspective, the site uses HTTPS with a valid SSL configuration and employs domain transfer protection. However, DNSSEC is not enabled, and no explicit HTTP security headers were detected in the provided data. There is no publicly visible security policy or incident response information, which could be improved to enhance trust and transparency. No vulnerabilities or exposed sensitive data were found in the analysis. Overall, KINESSO presents a credible, professional, and secure online presence suitable for its market positioning. Strategic recommendations include enabling DNSSEC, publishing a security policy and incident response page, implementing security headers, and considering a vulnerability disclosure program to further strengthen security posture and trust.

15
95
2
70
67
80
100
performancemarketingdata-drivenmarketingaisolutionsmediabuyingdigitalexperience+1 more
Google Tag ManagerGoogle FontsVimeo Player APIjQuery+2

Partner Domains:

ipgmediabrands.com
parent
2025-06-27T12:56:14.606Z
bcntele.com favicon

BCN Telecom

bcntele.com

0
TelecommunicationsUnited StateslargeMEDIUM

BCN Telecom is a well-established telecommunications and technology solutions provider specializing in managed network, cloud, voice, and security services. The company positions itself as a leader with over 30 years of experience, serving thousands of business customers with tailored, scalable, and secure technology solutions. Their market presence is reinforced by numerous partnerships with major technology providers and a strong portfolio of certifications and awards. Technically, the website is built on WordPress with a modern tech stack including jQuery, Google Tag Manager, and advanced UI components like Slick Slider and Embla Carousel. The site is well-optimized for SEO, mobile responsiveness, and accessibility, providing a professional user experience. Privacy compliance is robust, featuring a comprehensive privacy policy and cookie consent mechanisms aligned with GDPR and CCPA standards. From a security perspective, the site uses HTTPS and implements cookie consent but lacks visible security headers in the HTML source, which could be improved. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of WHOIS registration data raises concerns about domain legitimacy and trustworthiness, despite the professional appearance and business credibility of the site. Overall, BCN Telecom presents a strong digital presence with good security and privacy practices but should address domain registration transparency and enhance security headers to improve trust and resilience.

30
95
17
55
57
80
100
telecommunicationstechnologymanagedservicesconnectivitycloud+2 more
jQueryYoast SEOGoogle Tag ManagerSlick Slider+3

Partner Domains:

tbs.bcntele.com
partner
2025-06-27T12:56:14.604Z
newhorizons-sfv.org favicon

New Horizons, Serving Individuals with Special Needs

newhorizons-sfv.org

0
Non-profitUnited StatesmediumMEDIUM

New Horizons is a well-established non-profit organization based in the San Fernando Valley, Los Angeles, dedicated to serving individuals with special needs. The organization offers a broad range of programs including connecting services, employment, residential living, and learning opportunities. The website reflects a mature digital presence with clear branding, consistent messaging, and a focus on community engagement through donations, volunteering, and events. The merger with The Campbell Center indicates strategic growth and partnership expansion. Technically, the website is built on WordPress using the Enfold theme, leveraging modern SEO and analytics tools such as Yoast SEO, Google Tag Manager, and Facebook Pixel. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. Security posture is adequate with HTTPS enabled and email obfuscation, but lacks advanced security headers and published security policies. Privacy compliance is basic, with no explicit privacy or cookie policies found, which is an area for improvement. Overall, the domain registration is privacy protected but consistent with the organization's profile and history, supporting legitimacy.

15
68
2
85
47
85
100
non-profitspecialneedscommunityservicesdisabilitysupportlosangeles+2 more
WordPressEnfold ThemeYoast SEOjQuery+3

Partner Domains:

thecampbell.org
partner
2025-06-27T12:56:14.090Z
grindex.com favicon

Grindex

grindex.com

0
EnergyUnited StatesmediumMEDIUM

Grindex is an established manufacturer specializing in industrial quality submersible dewatering pumps, including sludge, slurry, drainage, and stainless steel (inox) pumps. The company targets industrial sectors requiring robust pumping solutions for challenging fluids and environments. The website presents a professional and consistent brand image with comprehensive product information, case studies, and news updates, supporting its market position as a reliable pump manufacturer. Technically, the website employs modern JavaScript frameworks and analytics tools such as Google Tag Manager and Microsoft Application Insights, indicating a mature digital infrastructure. The site is mobile optimized and SEO friendly, though accessibility features are basic. Performance is moderate with asynchronous script loading and responsive design elements. From a security perspective, the site enforces HTTPS and uses secure forms with CSRF tokens, but lacks visible security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were detected. Privacy and cookie policies are comprehensive and GDPR compliant, but direct contact information like emails or phone numbers is absent, relying solely on contact forms. Overall, the website is professional and trustworthy, but the absence of WHOIS data for the domain raises concerns about domain registration transparency. Strategic improvements in security headers, incident response visibility, and direct contact information would enhance trust and compliance.

65
58
2
70
75
85
100
industrialpumpssubmersibledrainagesludge+4 more
JavaScriptGoogle Tag ManagerMicrosoft Application InsightsHandlebars.js
2025-06-27T12:56:13.956Z
ciee.org favicon

Council on International Educational Exchange (CIEE)

ciee.org

0
EducationUnited StateslargeMEDIUM

CIEE (Council on International Educational Exchange) is a well-established nonprofit organization specializing in international educational exchange programs since 1947. The organization offers a wide range of programs including study abroad for college and high school students, work abroad opportunities, internships, TEFL certification, and custom exchange programs. Their market position is strong as a leader in the education and nonprofit sectors, targeting students, educators, employers, and professionals globally. The website reflects a professional and comprehensive digital presence with clear navigation, rich content, and multiple engagement channels. Technically, the website is built on Drupal 10 CMS and integrates modern analytics and marketing tools such as Google Tag Manager, New Relic, Marketo, and various social media pixels. The site is mobile optimized, accessible, and SEO friendly, providing a good user experience. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, though explicit security headers and incident response information could be enhanced. The WHOIS data is unavailable due to a malformed query response, which slightly impacts domain trust analysis. However, the website's branding, contact information, and business details strongly support its legitimacy. Overall, CIEE demonstrates a mature digital infrastructure and a trustworthy online presence suitable for its nonprofit educational mission.

55
53
17
60
79
80
100
educationstudyabroadinternationalexchangenonprofitstudentprograms+4 more
Drupal 10 CMSGoogle Tag ManagerNew Relic Browser MonitoringMarketo Forms+6

Partner Domains:

my.ciee.org
partner
inext.com
partner
2025-06-27T12:56:13.610Z
unimar.com favicon

Unimar, Inc.

unimar.com

0
EnergyUnited StatesmediumMEDIUM

Unimar, Inc. is a well-established company specializing in FAA obstruction lighting and tower lighting solutions, serving industries such as energy and transportation. The company offers a range of products and services including custom FAA obstruction lighting design, certified lighting system installation, hazardous location controls, and IoT-based obstruction light monitoring. Their market position is strong, supported by certifications such as UL, ATEX, GOST, and FAA, and a long domain history dating back to 1997. The website is professionally designed on the Shopify platform, providing a good user experience with clear navigation and mobile optimization. Technically, the site uses modern e-commerce technologies and integrates analytics and marketing tools effectively. Security posture is solid with HTTPS and domain transfer lock, though DNSSEC is not enabled and privacy compliance mechanisms like cookie consent are lacking. Contact information is available primarily via phone and contact forms, with active social media presence on Twitter and LinkedIn. Overall, the site reflects a credible and trustworthy business with room for improvement in privacy compliance and security transparency.

75
70
2
70
57
85
100
faaobstructionlightingtowerlightingindustriallightinghazardouslocationlightingledobstructionlights+2 more
ShopifyjQueryBootstrapFont Awesome+3

Partner Domains:

unimarbls.myshopify.com
service
ebay.com
partner
2025-06-27T12:56:13.518Z
printifyapp.com favicon

Printify

printifyapp.com

0
E-commerceUnited StateslargeMEDIUM

Printify is a well-established print on demand and dropshipping platform founded in 2015, headquartered in the US with additional offices in Latvia and Estonia. It enables entrepreneurs and eCommerce sellers to create and sell custom products globally without upfront costs. The company has a strong market position with over 10 million trusted sellers and integrations with major eCommerce platforms such as Shopify, Etsy, TikTok, and Amazon. The website demonstrates excellent content quality, professional design, and clear navigation, targeting small to medium-sized businesses and individual sellers. Technically, Printify employs a modern technology stack centered around Angular, supported by Cloudflare DNS and CDN services. The site integrates multiple analytics and marketing tools including Heap, Segment, Google Tag Manager, TikTok Analytics, and FullStory, indicating a mature digital infrastructure. Performance and mobile optimization are excellent, with good accessibility and SEO practices. From a security perspective, the site enforces HTTPS with strong domain registration protections and uses multiple security best practices. However, DNSSEC is not enabled, and there is no published security.txt or explicit incident response contact, which are areas for improvement. Privacy compliance is robust with a comprehensive privacy policy, cookie consent mechanism, and GDPR adherence. Business credibility is high, supported by transparent company information, legal pages, and trust indicators such as testimonials and media mentions. Overall, Printify presents a low-risk profile with a strong security posture and mature business operations. Strategic recommendations include enabling DNSSEC, publishing a security.txt file, and enhancing incident response transparency to further strengthen trust and compliance.

15
53
2
82
75
85
100
printondemandecommercedropshippingcustomproductsprintify+2 more
Angular (ng-version=19.1.2)Cloudflare DNSHeap AnalyticsSegment Analytics+5
2025-06-27T12:56:13.483Z
ddstudio.com favicon

DDSTUDIO

ddstudio.com

0
TechnologyUnited StatessmallMEDIUM

DDSTUDIO is a boutique design consultancy specializing in industrial design, user experience (UX), and user interface (UI) design. Established in 1997, the company positions itself as a premier partner for industry innovators seeking strategic, business-driven design solutions that empower people, influence positive change, and drive commercial success. Their services focus on human-centered design methodologies to create compelling, market-ready products. The website reflects a mature digital presence with professional design, clear navigation, and comprehensive content including case studies and client testimonials, indicating a strong market position in the technology sector. Technically, the website is built on WordPress using the Enfold theme and Avia framework, incorporating modern JavaScript libraries such as Swiper.js and Tippy.js, and integrates analytics tools like HubSpot and Google Analytics. The site is mobile-optimized and accessible, with good SEO practices and performance rated as moderate. Security posture is adequate with HTTPS enforced and use of reCAPTCHA, but could be improved by enabling DNSSEC and adding security headers. Privacy compliance is strong, with clear cookie consent mechanisms and a comprehensive privacy policy. Overall, DDSTUDIO demonstrates a solid security and compliance posture with no critical vulnerabilities detected. The domain registration is consistent with the business history, enhancing trustworthiness. Strategic recommendations include enhancing DNS security, publishing a security.txt file, and improving security header implementation to further strengthen the security posture.

15
68
17
70
52
85
40
uxuiindustrialdesignhuman-centereddesignproductdesign+2 more
WordPressEnfold ThemejQueryGoogle Fonts+5
2025-06-27T12:56:12.686Z